DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP4A11

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:506 Identity:154/506 - (30%)
Similarity:261/506 - (51%) Gaps:71/506 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LIGAMQLMLRLNPKTFIKVGREYVLK-------------FGHLQRV------------------- 71
            ||.|:||.|.          |:::||             |||:|.:                   
Human    31 LIKAVQLYLH----------RQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSA 85

  Fly    72 ---WIF-NRLLIMSGDAELNEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGKVWHQRRKIITPT 132
               |:: .::.:...|.:..:.:|...:. ..|..|:.|..|:|.||||.:|:.|.|.|:::||.
Human    86 CPHWLWGGKVRVQLYDPDYMKVILGRSDP-KSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPA 149

  Fly   133 FHFSILEQFVEVFDQQSNICVQRLAQ-KANGNTFDVYRSICAAALDIIAETAMGTKIYAQAN-ES 195
            ||:.||:.:|.:......:.:.:..: ....:..:|::.:....||.|.:.|...:...|.: .|
Human   150 FHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGSIQVDRNS 214

  Fly   196 TPYAEAVNECTALLSWRFMSVYLQVELLFTLTHPHLKW--RQTQLIRTMQEFTIKVIEKRRQALE 258
            ..|.:|:::...|:..|..:.:.|.:.:::||... :|  |..||   ..:.|.:||:.|:..|:
Human   215 QSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAG-RWTHRACQL---AHQHTDQVIQLRKAQLQ 275

  Fly   259 DQQSKLMDTADEDVGSKRRMALLDVLLMSTVD-GRPLTNDEIREEVDTFMFEGHDTTTSALSFCL 322
             ::.:|     |.:..||.:..||:||::.:: |..|::.::|.|||||||||||||.|.:|:.|
Human   276 -KEGEL-----EKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWIL 334

  Fly   323 HELSRHPEVQAKMLEEIVQVLGTDRSRPVSIRDLGELKYMECVIKESLRMYPPVPIVGRKLQTDF 387
            :.|:.||:.|.:..|||..:||...|  ::...|.::.|....|||:||:|||||.:||:|.|..
Human   335 YALATHPKHQERCREEIHSLLGDGAS--ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPV 397

  Fly   388 KYTHSVHGDG-VIPAGSEIIIGIFGVHRQPETFPNPDEFIPERHENGSRVAPFKMIPFSAGPRNC 451
            .:.     || .:|.|..:::.|:|:|..|:.:|||:.|.|.|...||.......:|||.|.|||
Human   398 TFP-----DGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNC 457

  Fly   452 IGQKFAQLEMKMMLAKIVREYELLPMGQRVEC-IVNIVLRSETGFQLGMRK 501
            ||::||..|:|:..|..:..:||||...|:.. |..:||:|:.|..|.:|:
Human   458 IGKQFAMNELKVATALTLLRFELLPDPTRIPIPIARLVLKSKNGIHLRLRR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 142/460 (31%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 143/470 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154742
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.