DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d8 and CYP46A1

DIOPT Version :9

Sequence 1:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_006659.1 Gene:CYP46A1 / 10858 HGNCID:2641 Length:500 Species:Homo sapiens


Alignment Length:506 Identity:142/506 - (28%)
Similarity:249/506 - (49%) Gaps:70/506 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLFLLVVLLFG-AGWIIHLGQADRRRKVANLPGPICPP-LIGAMQLMLR---LNPKTFIKVGRE 60
            :||...|:|.|| ....:|..    |.:..::|||..|. |:|.:....:   :..:....|..:
Human     6 LLLGSAVLLAFGLCCTFVHRA----RSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLD 66

  Fly    61 YVLKFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKHPVYK----VLGQWL-GNGLLLS-DG 119
            :..|:|.:.||.:|::..::....|..::.|.|.::.....:|:    |.|:.| |.||:.. :.
Human    67 WAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNY 131

  Fly   120 KVWHQRRKIITPTFHFSILEQFVEVFDQQSNICVQRLAQKANGNT-FDVYRSICAAALDIIAETA 183
            :.||::|::|...|..|.|...:|.|::::...|:.|..||:|.| ..:...:...|:||:|:.|
Human   132 ERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAA 196

  Fly   184 MGTKIYAQANESTPYAEAVNECTALLSWRFMSVYLQVELLFTLTHPHLKWRQTQLIRTMQEFTIK 248
            .|.:.........|.::||.              |.:|.:            |....|:.:|   
Human   197 FGMETSMLLGAQKPLSQAVK--------------LMLEGI------------TASRNTLAKF--- 232

  Fly   249 VIEKRRQALEDQQS-KLMDTADEDVGSKRRMAL-------LDVL--LMSTVDGRPLTNDE-IREE 302
            :..||:|..|.::| :.:.....|...:||.||       .|:|  ::...:|  ..:|| :.:.
Human   233 LPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEG--AQDDEGLLDN 295

  Fly   303 VDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSIRDLGELKYMECVIK 367
            ..||...||:|:.:.|:|.:.||||.||:.|::..|:.:|:|:  .|.:...|||.|:|:..|:|
Human   296 FVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGS--KRYLDFEDLGRLQYLSQVLK 358

  Fly   368 ESLRMYPPVPIVGRKLQTDFKYTHSVHGDGV-IPAGSEIIIGIFGVHRQPETFPNPDEFIPERHE 431
            ||||:|||.....|.|:.:...      ||| :|..:.::...:.:.|....|.:|..|.|:|..
Human   359 ESLRLYPPAWGTFRLLEEETLI------DGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFG 417

  Fly   432 NGSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVR--EYELLPMGQR 480
            .|:....|...|||.|.|:||||:|||:|:|:::||:::  |:.|:| |||
Human   418 PGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVP-GQR 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 126/436 (29%)
CYP46A1NP_006659.1 p450 34..466 CDD:365848 131/471 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.