DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and AT5G51900

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_200003.1 Gene:AT5G51900 / 835265 AraportID:AT5G51900 Length:242 Species:Arabidopsis thaliana


Alignment Length:258 Identity:46/258 - (17%)
Similarity:82/258 - (31%) Gaps:84/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 LNDEHNNLMAMHQSQNQLKIENGLDIYQLRPIPLKD---HKSLLEILLESKDPQLTGEEICGELN 295
            :.|.|.||:..|     :|::.  ..|||.. |:.|   ..::..:||..:|             
plant    59 IRDSHANLLTSH-----IKLDT--TQYQLLD-PINDKFLRDNVFALLLAGRD------------- 102

  Fly   296 TCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDELNLAQIKDQGWDLEKLNYLDAVLHETMRLYP 360
                    ..:.||.:....::.||.|..|...|:                              
plant   103 --------TTASALTWFFWFLSENPLVVTKIRQEI------------------------------ 129

  Fly   361 PQVIVGRQLKKDFPYTHSIVGDAELPCGSEIYINLYE---LQRNEVRYPKANHFDAQRFLDSPPE 422
                       |.....|..|.....|....|:|..:   :.|..:|.       ..|.:|....
plant   130 -----------DMNLPRSCSGQERPSCDPMEYLNKDDESCMGRRCIRI-------QAREMDFRDR 176

  Fly   423 LLSYSLGPRCCPARKFSMQLLKTLLAPILANFEV-LPYGDEVRLDLRLVLGSSNGFQLALKPR 484
            .:|.....|.|..::.:|..:|.:...||.|::: :..|.:...|..|:|...:||::.:..|
plant   177 RVSIQCRSRICHGKQRAMVQMKIVAVEILQNYDIKVANGQKFEPDTSLILKMKHGFKVKINKR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 40/238 (17%)
AT5G51900NP_200003.1 p450 <2..239 CDD:299894 45/256 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.