DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and CYP96A13

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_195910.1 Gene:CYP96A13 / 831752 AraportID:AT5G02900 Length:480 Species:Arabidopsis thaliana


Alignment Length:480 Identity:108/480 - (22%)
Similarity:178/480 - (37%) Gaps:116/480 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WPLMGAMHKLLFLTPINFFQRSTEYLTKYGTFSRCWVFHRLFIPLADLELSRQLLENDTHLETGY 101
            ||::|.:..||.                        .|||::      :.|.::|||.   :..:
plant    26 WPVLGMLPGLLL------------------------EFHRIY------DFSVEVLENS---DLTF 57

  Fly   102 ELMKDWLVGGVLMCQSEQWQKRHSLISGL--FDKG-NLEQLID-------------LSRHQTEQL 150
            .....|..|..::...:.....|.:.|..  :.|| :.:|:.|             |.::..:..
plant    58 PFKGPWFTGMDMLFTVDPTNIHHIMSSNFSNYTKGPDFKQVFDVFGDGILTTDDSELWKNLKKAS 122

  Fly   151 LQKLAKQADQK---VFDIWYTVSPIVLDLMVMTTCGA---------KPSEEYSKNLKDLSE---- 199
            |..|..|..||   |.|:.......:.|..::|..|:         .|..|::|.|..:.|    
plant   123 LVMLNHQGFQKNGTVVDLQDVFKRFMFDTTLVTVTGSADPRSLSIEMPEVEFAKALDHVGEGIMH 187

  Fly   200 -IYRKRFL-SLQSANRFNYWLSSPFMRKRQNRLIKRLNDEHNNLMAMH--------QSQNQLKIE 254
             ..|.|.| .||....|.           |.:...:.:...|...|.:        :||......
plant   188 RHVRPRLLWKLQKCVGFG-----------QEKKFSKADATLNQACAKYILEKREETRSQGFDYHS 241

  Fly   255 NGLDIYQLRPIPLKDHKSLLEILLESKDPQLTGEEICGELNTCNYLGYQLCSPALCFCLVTIARN 319
            ||.:...:....:|...:..|:|..|.|..|....:...|     .|....:.||.:....:..|
plant   242 NGSESEDILTYHIKIDTTKYELLNPSDDKFLRDTILAFVL-----AGRDTTASALTWFFWLLLEN 301

  Fly   320 PSVQQKCLDELNLA---QIKDQGWDLEKLN---YLDAVLHETMRLYPPQVIVGRQ--LKKD-FPY 375
            |.|..|...|:|.:   |.|.....:|.||   ||...|:|.|||||| |...|.  :|.| .|.
plant   302 PQVVTKIRQEINTSNGGQEKPSCEPMEYLNNLVYLHGALYEAMRLYPP-VPFERMSPIKPDVLPS 365

  Fly   376 THSIVGDAELPCGSEIYINLYELQRNEVRYPK-ANHFDAQRFLDSPPEL--------LSYSLGPR 431
            .|.:  |:.:    :|.|.:|.|.|....:.: |:.|..:|:|.....|        |:::.|||
plant   366 GHKV--DSSM----KILIFIYALGRMRAVWGEDASEFKPERWLSETTSLRHEPSFKFLAFNAGPR 424

  Fly   432 CCPARKFSMQLLKTLLAPILANFEV 456
            .|..::.:|.|:|.::..||.|:::
plant   425 SCIGKQLAMTLMKIVVVEILQNYDI 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 108/480 (23%)
CYP96A13NP_195910.1 p450 1..479 CDD:299894 108/480 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.