DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and CYP702A5

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001078393.1 Gene:CYP702A5 / 827206 AraportID:AT4G15393 Length:467 Species:Arabidopsis thaliana


Alignment Length:500 Identity:91/500 - (18%)
Similarity:172/500 - (34%) Gaps:138/500 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GPFTWPLMGAMHKLLFLTPINFFQRST---EYLTKYGTFSRCWVFHRLFIPLADLELSRQLLEND 94
            |...:|::|...:  |:...:..|..|   |.|.::|...|..:|....|...|:.|:.::.:.:
plant    38 GSMGYPIIGETFE--FMKLHDAIQLPTFVKEKLLRHGPVFRTSLFGGKVIISTDIGLNMEIAKTN 100

  Fly    95 THLETGYELMKDWLVGGVLMCQSEQWQKRHSLISGLFDKGNLEQLIDLSRHQTEQLLQK--LAKQ 157
             |: .|.....:.|.|...:..::...|....::..| .|:  |.:.|...|....|.:  :.:.
plant   101 -HI-PGMPKSLERLFGATNLFVNKDTHKHARSLTNQF-LGS--QALKLRMIQDIDFLARTHMKEG 160

  Fly   158 ADQKVFDIWYTVSPIVLDLMVMTTCGAKPSEEYSKNL--------KDL---------SEIYRKRF 205
            |.:...|:..|.|.||::.:.....| :...|.:|.|        :|.         :.:||   
plant   161 ARKGCLDVKETASKIVIECLSKKVMG-EMEPEAAKELTLCWTFFPRDWFRFAWNFPGTGVYR--- 221

  Fly   206 LSLQSANRFNYWLSSPFMRKRQNRLIKRLNDEHNNLMAMHQSQNQLKIENGLDIYQLRPIPLKDH 270
             .:::.||....:....::||.:.  |:|.:                                  
plant   222 -IVKARNRMMKVIKETVVKKRASG--KKLGE---------------------------------- 249

  Fly   271 KSLLEILLESKDPQLTGEEICGE-LNTCNYLGYQLCSPALCFCLVTIARNPSVQQK--------C 326
              ..|.:....:......||..| :.|...|..:.....|...:..|:.||.|.|:        .
plant   250 --FFETIFGDTESVTMSIEIATEYIFTLFVLANETTPGVLAATIKLISDNPKVMQELRREHEGIV 312

  Fly   327 LDELNLAQIKDQGW-DLEKLNYLDAVLHETMRLYPPQVIVGRQLKKDFPYTHSIVGDAELPCGSE 390
            .|::...:..|..| |.:.:.:...|::|::|:......|.|.:..:..:     ||..:|.| .
plant   313 QDKIKKDETADLTWEDYKSMTFTQMVINESLRITSTVPTVLRIIDHEIQF-----GDYTIPAG-W 371

  Fly   391 IYINLYELQRNEVRYPKANHFDAQRFLDSP------------------PELLSYSLGPRCCPARK 437
            |::.          ||.. ||:.::: |.|                  ...|.:..|.|.|...:
plant   372 IFMG----------YPYV-HFNPEKY-DDPLAFNPWRWKGKDLSTIVSKTYLPFGSGTRLCVGAE 424

  Fly   438 F-----------------SMQLLKTLLAPILANFEVLPYGDEVRL 465
            |                 ||:...|||...:.   |||.|.:|::
plant   425 FVKLQMAIFIHHLFRYRWSMKAETTLLRRFIL---VLPRGSDVQI 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 91/499 (18%)
CYP702A5NP_001078393.1 p450 30..448 CDD:386267 83/477 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.