DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and AT3G44970

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_190083.2 Gene:AT3G44970 / 823632 AraportID:AT3G44970 Length:479 Species:Arabidopsis thaliana


Alignment Length:502 Identity:96/502 - (19%)
Similarity:184/502 - (36%) Gaps:135/502 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GPFTWPLMGAMHKLLFLTPINFFQRSTEYLTK----YGTFSRCWVFHRLFIPLADLELSRQLLEN 93
            |...:|::|  ..|.|..|..|::.| .||.|    ||...|..:.....:...|.:::.::|..
plant    38 GSMGFPIIG--ETLDFFKPYGFYEIS-PYLKKKMLRYGPLFRTNILGVKTVVSTDKDVNMEILRQ 99

  Fly    94 DTHLETGYELMKDWLVG---GVLMCQSEQWQKRHSLISGLFDK-GNLEQLI-DLSRH--QTEQLL 151
            :.         |.:::.   |::....:         ..||.| ||:.:.| .::.|  .:|.|.
plant   100 EN---------KSFILSYPDGLMKPLGK---------DSLFLKIGNIHKHIKQITLHLLSSEGLK 146

  Fly   152 QKLAKQADQKV------------FDIWYTVSPIVLDLMVMTTCGAKPSEEYSKNLKDLSEIYRKR 204
            :|:.|..|:..            .|:...||.:::         |..:.:...|||..::   .:
plant   147 RKILKDMDRVTREHLSSKAKTGRLDVKDAVSKLII---------AHLTPKMMSNLKPQTQ---AK 199

  Fly   205 FLSLQSANRFNYWLSSPFMRKRQNRLIKRLNDEHNNLMAMHQSQNQLKIENGLDIYQLRPIPLKD 269
            .:.:..|..|:::        |.:.||......:|.|.|..:...::|     |||.:|....:.
plant   200 LMGIFKAFTFDWF--------RTSYLISAGKGLYNTLWACREGMREIK-----DIYTMRKTSEEK 251

  Fly   270 HKSLLEILLE--SKDPQLTGEE-ICGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDE-- 329
            :...|...:|  .|..:|..|. |...:.|.:.:.....|.|:|..:..:..||.|..:...|  
plant   252 YDDFLNTAIEESEKAGELLNENAIITLIFTLSCVTQDTTSKAICLAVKFLLENPKVLAELKKEHE 316

  Fly   330 --LNLAQIKDQG--WD--LEKLNYLDAVLHETMRLYPPQVIVGRQLKKDFP---YTHSIVGDAEL 385
              |...:.|:.|  |:  ..|:.:.:.|::|::|:.....::.|:..||..   ||        :
plant   317 VILESREDKEGGVTWEEYRHKMTFTNMVINESLRITNLAPMLFRKAVKDVEIKGYT--------I 373

  Fly   386 PCGSEIYINLYELQRNEVRYPKANHFDAQRFLDSPPE-----------------LLSYSLGPRCC 433
            |.|..:.|           .|...|||.:.: ::|.|                 .:.:..|.|.|
plant   374 PAGWIVMI-----------IPSVVHFDPEIY-ENPFEFNPWRWEGKELRAGSKTFMVFGTGLRQC 426

  Fly   434 PARKFSMQLLKTLLAPILA--NFEV-------------LPYGDEVRL 465
            ...:|:...:...|..::.  ||.:             ||.|..:.:
plant   427 AGAEFARLQISVFLHHLVTTYNFSLHQDCEVLRVPAAHLPNGISINI 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 96/502 (19%)
AT3G44970NP_190083.2 p450 34..475 CDD:299894 96/502 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.