DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:533 Identity:128/533 - (24%)
Similarity:218/533 - (40%) Gaps:106/533 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ICFCLA----SAFNYFRARRQRSLIKNLKGPFTWPLMGAMHKLL----FLTPINFFQRSTEYLTK 64
            :.||||    .|...: .|||| |:::| .||..|   ..|.||    ||...| .:...|.:.|
Mouse    18 LVFCLALVLMQAMKLY-LRRQR-LLRDL-SPFPGP---PAHWLLGHQKFLQEDN-METLDEIVKK 75

  Fly    65 YGTFSRCWV-----FHRLFIP-LADLELSRQLLENDTHLETGYELMKDWLVGGVLMCQSEQWQKR 123
            :.....|||     |..::.| .|.:.|||    .|..::..::|:...:..|:|.....:|.:.
Mouse    76 HPCAFPCWVGPFQAFFYIYDPDYAKIFLSR----TDPKMQYLHQLLTPCIGRGLLNLDGPRWFQH 136

  Fly   124 HSLISGLFDKGNLEQLIDLSRHQTEQLLQKLAKQ--ADQKVFDIWYTVSPIVLDLMVMTTCGAKP 186
            ..|::..|.:..|:..:|...|..:.:|.|..|.  ..:...:::..::.:.||:::....|.:.
Mouse   137 RCLLTPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQET 201

  Fly   187 S-------EEYSKNLKDLSEIYRKRFLSLQSANRFNYWLSSPFMRKRQNRLIKRLNDEHNNLMAM 244
            :       |.|.|...:|.||...|.        :|:|                   .|::::..
Mouse   202 NCQINGTYESYVKATFELGEIISSRL--------YNFW-------------------HHHDIIFK 239

  Fly   245 HQSQNQLKIENGLDIYQLRPIPLKDHKSLLEILLESKDPQ-------------------LTGEEI 290
            ...:.....|.|..|:|.....::|.|.:|:..::..|.|                   .:..::
Mouse   240 LSPKGHCFQELGKVIHQYTEKIIQDRKKILKNQVKQDDTQTSQIFLDIVLSAQAEDERAFSDADL 304

  Fly   291 CGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDELNLAQIKDQG----WD-LEKLNYLDA 350
            ..|:||..:.|:...:.::.:.|..:|.||..|.:|..|:.  .|...|    |: |::::|...
Mouse   305 RAEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIR--SILGDGSSITWEQLDEMSYTTM 367

  Fly   351 VLHETMRLYPPQVIVGRQLKK--DFPYTHSIVGDAELPCGSEIYINLYELQRNEVRYPKANHFDA 413
            .:.||:||.||...:.|:|.|  ..|..||      ||.|..:.::::.|..|...:.....||.
Mouse   368 CIKETLRLIPPVPSISRELSKPLTLPDGHS------LPAGMTVVLSIWGLHHNPAVWNDPKVFDP 426

  Fly   414 QRFLDS------PPELLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPYGDEVR---LDLRL 469
            .||...      |...|.:|.|||.|..::|:|..||..:|.||.:|:|.|  |..|   .....
Mouse   427 LRFTKENSDQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALILLHFQVAP--DLTRPPAFSSHT 489

  Fly   470 VLGSSNGFQLALK 482
            ||...:|..|.||
Mouse   490 VLRPKHGIYLHLK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 111/486 (23%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 112/496 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.