DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and CYP710A4

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_180452.1 Gene:CYP710A4 / 817435 AraportID:AT2G28860 Length:493 Species:Arabidopsis thaliana


Alignment Length:507 Identity:105/507 - (20%)
Similarity:191/507 - (37%) Gaps:118/507 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTATFICFCLASAFNYFRARRQRSLIKNLKGP-FTWPLMGAMHKLLFLTPINFFQRSTEYLTKYG 66
            |.:..:.|.|.... ::|.::     :||.|| |.:|::|.:..|: ..|.:|:.:.:.......
plant    15 LVSALLLFLLLEQL-FYRVKK-----RNLPGPLFVFPIIGNVVALI-RDPTSFWDKQSAMADTSV 72

  Fly    67 TFSRCWVFHRLFIPLADLELSRQLLEN---DTHLETGYELMKDWLVGG---VLMCQSEQWQKRHS 125
            ..|..::..:..|.:.|.|||.::|.|   |....||:...|. |.|.   :.|...:....|..
plant    73 GLSVNYLIGKFIIYIKDAELSNKVLSNIRPDAFQLTGHPFGKK-LFGDHSLIFMFGEDHKSVRRQ 136

  Fly   126 LISGLFDK-----GNLEQLIDLSRH---------------QTEQLLQKLAKQADQKVFDIWYTVS 170
            :......|     .:|:|::.| ||               ...||:::|..:..|.||     |.
plant   137 VAPNFTRKPLSAYSSLQQIVIL-RHLRQWEESFSSGSRPVSMRQLIRELNLETSQTVF-----VG 195

  Fly   171 PIVLDLMVMTTCGAKPSEEYSKNLKDLSEIYRKRFLSLQSANRFNYWLSSP-------FMRKRQ- 227
            |.:...:..|.|     ::||             .|:|.:       ::.|       |...|| 
plant   196 PYLDKEVKKTIC-----DDYS-------------LLTLGT-------MAIPIDLPGFTFGEARQA 235

  Fly   228 -NRLIKRLNDEHNNLMAMHQSQNQLKIENGLDIYQLRPIPLKD---HKSLLEILLESKDPQLTGE 288
             :||:        |.|::...:::.|:..|.:     |..|.|   |..:.|   ....|....:
plant   236 VSRLV--------NTMSVCVGKSKAKMAAGEN-----PTCLVDFWTHSIIEE---NPPPPHSKDK 284

  Fly   289 EICGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLD--------ELNLAQIKDQGWDLEKL 345
            ||...|....:......:.:|.:.:|.:...|.|.::..:        |.|.....||   |.::
plant   285 EISCVLVDFMFASQDASTSSLLWAVVMLESEPEVLRRVREDVARFWSSESNELITADQ---LAEM 346

  Fly   346 NYLDAVLHETMRLYPPQVIVGRQLKKDFPYTHSIVGDAELPCGSEIYINLYELQRNEVRYPKANH 410
            .|..||..|.:|..||..::......||..|.|..    :|.|:.::.:|::........|  :.
plant   347 KYTRAVAREVLRYRPPASMIPHVAVSDFRLTESYT----IPKGTIVFPSLFDASFQGFTEP--DR 405

  Fly   411 FDAQRFLDSPPE-------LLSYSLGPRCCPARKFSMQLLKTLLAPILANFE 455
            ||..||.::..|       .|::..|...|..::::|..|...:|...:.|:
plant   406 FDPDRFSETRQEDEVFKRNFLTFGNGSHQCVGQRYAMNHLVLFIAMFSSMFD 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 99/477 (21%)
CYP710A4NP_180452.1 p450 38..459 CDD:299894 99/478 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53736
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.