DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and CYP94C1

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_180337.1 Gene:CYP94C1 / 817315 AraportID:AT2G27690 Length:495 Species:Arabidopsis thaliana


Alignment Length:428 Identity:89/428 - (20%)
Similarity:165/428 - (38%) Gaps:97/428 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 WVFHRLFIPLADLELSRQLLENDTHLETGYELMKDWLVGGVLMCQSEQWQKRHSLISGLFDK-GN 135
            |.|.|   .||.|||....:....|     |::|..:...:|           .:::...|. |:
plant   121 WRFQR---KLASLELGSVSVRVFAH-----EIVKTEIETRLL-----------PILTSFSDNPGS 166

  Fly   136 LEQLIDLSRHQTEQLLQKLAKQADQKVFDIWYTVSPIVLDLMVMTTCGAKPSEEYSKNLKDLSEI 200
            :..|.|:.|..:...:.||:...|.....:.:.:|...:.....:...||      :.|.....:
plant   167 VLDLQDVFRRFSFDTISKLSFGFDPDCLRLPFPISEFAVAFDTASLLSAK------RALAPFPLL 225

  Fly   201 YR-KRFLSL-------QSANRFNYWLSSPFMRKRQNRLIKRLNDEHNNLMAMHQSQNQLKIENGL 257
            :: ||.|.:       :|.|..|. |:...:::|:...:...||..:..||:        :....
plant   226 WKTKRLLRIGSEKKLQESINVINR-LAGDLIKQRRLTGLMGKNDLISRFMAV--------VAEDD 281

  Fly   258 DIYQLRPIPLKDHKSLLEILLESKDPQLTGEEICGELNTCNYLGYQLCSPALCFCLVTIARNPSV 322
            |.| ||.|       ::..||..:|....|           ..|:        |.|:|  |:|.|
plant   282 DEY-LRDI-------VVSFLLAGRDTVAAG-----------LTGF--------FWLLT--RHPEV 317

  Fly   323 QQKCLDELNLAQIKDQGWD--------LEKLNYLDAVLHETMRLYPPQVIVGRQLKKDFPYTHSI 379
            :.:..:||:  ::...|:|        :.:::||.|.|:|:|||:||.     |....|.....:
plant   318 ENRIREELD--RVMGTGFDSVTARCDEMREMDYLHASLYESMRLFPPV-----QFDSKFALNDDV 375

  Fly   380 VGDAE-LPCGSEIYINLYELQR-NEVRYPKANHFDAQRFLD--------SPPELLSYSLGPRCCP 434
            :.|.. :..|:.:..:.|.:.| :.:..|....|..:|:||        :|.:...:..|.|.|.
plant   376 LSDGTFVNSGTRVTYHAYAMGRMDRIWGPDYEEFKPERWLDNEGKFRPENPVKYPVFQAGARVCI 440

  Fly   435 ARKFSMQLLKTLLAPILANFEVLPYGDEVRLDLRLVLG 472
            .::.::..:|::...|:..||......|....||...|
plant   441 GKEMAIMEMKSIAVAIIRRFETRVASPETTETLRFAPG 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 86/420 (20%)
CYP94C1NP_180337.1 PLN02426 23..495 CDD:215235 89/428 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53736
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.