DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_077764.2 Gene:Cyp4f18 / 72054 MGIID:1919304 Length:524 Species:Mus musculus


Alignment Length:478 Identity:122/478 - (25%)
Similarity:209/478 - (43%) Gaps:69/478 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 INFFQRSTEYLTKYGTFSR------CW----------VFHRLFI-PLADLELSRQLL-ENDTHLE 98
            :...|.|.|.|....:..|      ||          :||..|| |:.   |:..|: ..||   
Mouse    64 LGLIQSSEEGLLYIQSLVRTFRDACCWWVGPLHPVIRIFHPAFIKPVV---LAPALVAPKDT--- 122

  Fly    99 TGYELMKDWLVGGVLMCQSEQWQKRHSLISGLFDKGNLEQLIDLSRHQTEQL---LQKLAKQADQ 160
            ..|..:|.||..|:||...::|.:...:::..|....|:..:.:....|..:   .|:||.:. .
Mouse   123 VFYRFLKPWLGDGLLMSTGDKWSRHRRMLTPAFHFNILKPYVKVFNDSTNIMHAKWQRLASKG-S 186

  Fly   161 KVFDIWYTVSPIVLDLMVM------TTCGAKPSEEYSKNLKDLSEIYRKRFLSLQSANRFNYWLS 219
            ...:::..:|.:.||.:..      :.|..||| ||...:.:||.:..:|...|.......|:|:
Mouse   187 AYLNMFEHISLMTLDSLQKCVFSFDSNCQEKPS-EYITAILELSTLVARRHQRLLLHVDLFYYLT 250

  Fly   220 SPFMRKRQN-RLIKRLNDEHNNLMAMHQSQNQLKIENGLDIYQLRPIPLKDHKSL--LEILLESK 281
            ...||.|:. ||:....|     ..:.:.:..|..:.|:|:.:.:    ...|:|  :::||.||
Mouse   251 HDGMRFRKACRLVHDFTD-----AVIRERRRTLLDQGGVDVLKAK----AKAKTLDFIDVLLLSK 306

  Fly   282 DPQ---LTGEEICGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDELNLAQIKDQ----- 338
            |..   |:.|:|..|.:|..:.|:...:..|.:.|..:||:|..|::|..|:. ..::|:     
Mouse   307 DEHGKALSDEDIRAEADTFMFGGHDTTASGLSWILYNLARHPEYQERCRQEVR-ELLRDREPEEI 370

  Fly   339 GW-DLEKLNYLDAVLHETMRLYPPQVIVGRQLKKDFPYTHSIVGDAE-LPCGSEIYINLYELQRN 401
            .| ||.:|.:|...:.|::||:||...:.|...:|.     ::.|.. :|.|....|:::....|
Mouse   371 EWDDLAQLPFLTMCIKESLRLHPPVTAISRCCTQDI-----VLPDGRVIPKGVISRISIFGTHHN 430

  Fly   402 EVRYPKANHFDAQRF-LD-----SPPELLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPYG 460
            ...:|....:|..|| .|     ||...:.:|.|||.|..:.|:|..:|..||..|..|.|||..
Mouse   431 PAVWPDPEVYDPFRFDADNVKGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRVLPDD 495

  Fly   461 DEVRLDLRLVLGSSNGFQLALKP 483
            .|.|....|:|.:..|..|.::|
Mouse   496 KEPRRKPELILRAEGGLWLKVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 117/459 (25%)
Cyp4f18NP_077764.2 p450 52..516 CDD:365848 121/474 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.