DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:521 Identity:113/521 - (21%)
Similarity:191/521 - (36%) Gaps:125/521 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILTATFICFCLASAFNYFRARRQRSLIKNLKGPFTWPLMGAMHKLLFLTPINFFQRSTEYLTKY 65
            ::||...:.|.|...::|||:|.    |.:|. |.:|..||.:.:||||.            ..:
  Fly     7 LLLTIVTLNFWLRHKYDYFRSRG----IPHLP-PSSWSPMGNLGQLLFLR------------ISF 54

  Fly    66 GTFSR---------------CWVFHRLFIPLADLELSRQ-LLENDTHLETGYELMKDWLVGGVL- 113
            |...|               .::|....:.:.|.||.|| |::|..:....:|........|.| 
  Fly    55 GDLFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALT 119

  Fly   114 --MCQSEQWQKRHSLISGLFDKGNL-----EQLIDLSRHQTEQLLQKLAKQADQKVFDIWYTVSP 171
              :.:...|::....:|.||..|.:     .|::|::....:.|.:||..:.::        |.|
  Fly   120 LPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLER--------VLP 176

  Fly   172 IVLDLMVMTTCGAKPSEEYSKNLKDL----SEIYRKR-------------FLSLQSANRFNYWLS 219
            :.....:.|| ....:..||.|:..|    ||:..|.             |:|:....::...|.
  Fly   177 LGRMCQLYTT-DVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLK 240

  Fly   220 SPFMRKRQNRLIKRLNDEHNNLMAMHQSQ-----NQL---KIENGLDIYQLRPIPLKDHKSLLEI 276
            .....:...|.::.|.|:|      |:..     |||   ::....:.|...|            
  Fly   241 PKVFTEDYARYMRHLVDDH------HEPTKGDLINQLQHFQLSRSSNHYSQHP------------ 287

  Fly   277 LLESKDPQLTGEEICGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDELNLAQIKDQ--G 339
                       :.:..:.......|::..|..:.|.|..:|:.|.:|::...||..|.|...  .
  Fly   288 -----------DFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLS 341

  Fly   340 WD-LEKLNYLDAVLHETMRLYPPQVIVGRQLKKDF-------PYTHSIVGDAELPCGSEIYINLY 396
            :| |..|.||..|..|.:||||....|.|:.....       |:...||     |.|...||::.
  Fly   342 YDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIV-----PPGMPAYISIL 401

  Fly   397 ELQRNEVRYPKANHFDAQRFLDS------PPELLSYSLGPRCCPARKFSMQLLKTLLAPILANFE 455
            .|.|:|..:|:...||.:||...      |...:.:..||..|...:..:..||..:..||..:.
  Fly   402 GLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYW 466

  Fly   456 V 456
            |
  Fly   467 V 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 103/489 (21%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 103/490 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.