DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:591 Identity:126/591 - (21%)
Similarity:228/591 - (38%) Gaps:175/591 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ATFICFCLASAFNYFRARRQRSLIKNLKG-------PFTWPLMGAMHKLLFLTPINFFQRSTEYL 62
            |.:.|..|.:....::.|:...||..|.|       |..|.|:     .:.|.|.:..::.::|.
  Fly     6 ALWACGALLAVLLAWQQRKCWRLIWQLNGWRGVIQQPVLWLLL-----CINLHPNSILEKVSQYR 65

  Fly    63 TKYGTFSRCWVFHRLFIPLADLELSRQLLEND-----------------THLETGYELMKDWLVG 110
            ..         |.|   |||.|..:|.||..|                 |.|:.|:.:.:     
  Fly    66 VH---------FQR---PLAVLVGTRVLLYIDDPAGMECVLNAPECLDKTFLQDGFFVRR----- 113

  Fly   111 GVLMCQSEQWQKR---------HSLISGLFDKGNL--EQLIDLSRHQTEQLLQKLAKQADQKVFD 164
            |:|..:.::|:.|         |::::..||..|.  .|:::..:.||....|.:...|.:.:  
  Fly   114 GLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQMVEQFQTQTNLHGQAVKFTAAEDL-- 176

  Fly   165 IWYTVSPIVLDLMVMTTCGAKPSEEYSKNLKDLSEIY----RKRFLSLQSANRFNYWLS------ 219
                :|..||::..:|..|. |:     |...|.:.:    .||.|.:.:......||.      
  Fly   177 ----LSRAVLEVSCLTIMGT-PT-----NFTQLDDAHIAHSYKRLLEISAVRVVKPWLQIRLLHR 231

  Fly   220 --SPFMRKRQNRLIKRLND--------EHNNLM-------------AMHQSQNQLKIENGLDIYQ 261
              :|.:.:...:..|.|.|        :|.|..             |.:..|.::.||   .|:|
  Fly   232 LLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIE---QIFQ 293

  Fly   262 LRPIPLKDHKSLLEILLESKDPQLTGEEICGELNTCNYLGYQLCSPALCFCLVTIARNP-SVQQK 325
            |                 :.:.::|.|||..|..:...:.::..|.::...|:.:|.|. ..|::
  Fly   294 L-----------------AANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRR 341

  Fly   326 CLDELNLAQIKDQGW----DLEKLNYLDAVLHETMRLYPPQVIVGRQLKKDFPYT---HSIVGDA 383
            .|.|:. |.:.|.|.    .|::|.||||.:.|::||.....:..|.:.:||...   |..:   
  Fly   342 LLAEIR-ALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETI--- 402

  Fly   384 ELPCGSEIYINLYELQRNEVRYPKAN--HFDAQRFLDSPPELLS--------------------- 425
             :|..|.:.::.:.:||:| |:..||  .||.|||||...|.||                     
  Fly   403 -VPQNSIVVLDTFNMQRDE-RWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSY 465

  Fly   426 ----YSLGPRCCPARKFSMQLLKTLLAPILANF--------EVLPYGDEVRLDLRLVLGSSNGFQ 478
                :|.|.|.|..|::.:.::|..|..::.||        |.|.:.:.:.|..:    :::...
  Fly   466 SFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFK----NADDIL 526

  Fly   479 LALKPR 484
            |.::|:
  Fly   527 LTIQPK 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 116/543 (21%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 113/520 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.