DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_006241152.1 Gene:Cyp4f39 / 299566 RGDID:1308796 Length:550 Species:Rattus norvegicus


Alignment Length:524 Identity:123/524 - (23%)
Similarity:223/524 - (42%) Gaps:64/524 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILTATFICF-CLASAFNYFR----ARRQRSLIKNLKGPFTWPLMGAMHKLLFLTPINFFQRSTE 60
            ::|...|:.| .|..||..|.    ..|:.|......|.. | |:|  |..::|......|...:
  Rat    27 LLLFLLFLLFRLLLQAFKLFSDFRITCRRLSCFPEPPGRH-W-LLG--HMSMYLPNEKGLQNEKK 87

  Fly    61 YLTKYGTFSRCWVFHRLFIPL----------ADLELSRQLLENDTHLETGYELMKDWLVGGVLMC 115
            .|.........||  ..|:||          ..|..|..:...|   |..|..:|.||..|:|:.
  Rat    88 VLDTMHHIILAWV--GPFLPLLVLVHPDYIKPVLGASAAIAPKD---EFFYSFLKPWLGDGLLIS 147

  Fly   116 QSEQWQKRHSLISGLFDKGNLEQLIDLSRHQTEQLLQKLAKQ-ADQKV--FDIWYTVSPIVLDLM 177
            :..:|.:...|::..|....|:..:.:.......:..|..:. |:..|  ||::..||.:.||.:
  Rat   148 KGNKWSRHRRLLTPAFHFDILKPYMKIFNQSVNIMHAKWRRHLAEGSVTSFDMFEHVSLMTLDSL 212

  Fly   178 ------VMTTCGAKPSEEYSKNLKDLSEIYRKRFLSLQSANRFNYWLSSPFMRKRQNRLIKRLND 236
                  ..:.|..|.| :|..::.:||.:..:|...|.....|.|:|::...|.||     ..:.
  Rat   213 QKCVFSYSSDCQEKLS-DYISSIIELSALVVRRQYRLHHYLDFIYYLTADGRRFRQ-----ACDT 271

  Fly   237 EHNNLMAMHQSQNQLKIENGLDIYQLRPIPLKDHKSL--LEILLESKD---PQLTGEEICGELNT 296
            .||....:.|.:.:...|.|.:.:    :..|..|:|  :::||.:||   .:|:.|:|..|.:|
  Rat   272 VHNFTTEVIQQRRRALRELGAEAW----LKAKQGKTLDFIDVLLLAKDEEGKELSDEDIRAEADT 332

  Fly   297 CNYLGYQLCSPALCFCLVTIARNPSVQQKCLDELNLA----QIKDQGW-DLEKLNYLDAVLHETM 356
            ..:.|:...|..|.:.|..:|:.|..|.||.:|:...    ::::..| ||.:|.:....:.|::
  Rat   333 FMFEGHDTTSSGLSWALFNLAKYPEYQDKCREEIQEVMKGRELEELDWDDLTQLPFTTMCIKESL 397

  Fly   357 RLYPPQVIVGRQLKKDFPYTHSIVGDAELPCGSEIYINLYELQRNEVRYPKANHFDAQRF----- 416
            |.:||..::.|:..:|.......:    :|.|....:::|....|.:.:|.:..::..||     
  Rat   398 RQFPPVTLISRRCTEDIKLPDGRI----IPKGIICLVSIYGTHYNPLVWPDSKVYNPYRFDPDIP 458

  Fly   417 -LDSPPELLSYSLGPRCCPARKFSMQLLKTLLAPILANFEV-LPYGDEVRLDLRLVLGSSNGFQL 479
             ..||...:.:|.|||.|..:.|:|..::.::|..|..|.: :....:||....|:|.:.||..|
  Rat   459 QQRSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLRFRLSVDRTRKVRRKPELILRTENGLWL 523

  Fly   480 ALKP 483
            .::|
  Rat   524 NVEP 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 108/468 (23%)
Cyp4f39XP_006241152.1 CYP4F 82..523 CDD:410772 106/459 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.