DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and Cyp4f6

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_006241111.1 Gene:Cyp4f6 / 266689 RGDID:708365 Length:538 Species:Rattus norvegicus


Alignment Length:414 Identity:104/414 - (25%)
Similarity:187/414 - (45%) Gaps:47/414 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TGYELMKDWLVGGVLMCQSEQWQKRHSLISGLFDKGNLEQLIDLSRHQTEQL---LQKLAKQADQ 160
            |.|..:|.||..|:||...|:|.....|::..|....|:..:.:.......:   .|:|..:...
  Rat   124 TLYGFLKPWLGDGLLMSAGEKWNHHRRLLTPAFHFDILKSYVKIFNKSVNTMHAKWQRLTAKGSA 188

  Fly   161 KVFDIWYTVSPIVLDLMVM------TTCGAKPSEEYSKNLKDLSEIYRKR----FLSLQSANRFN 215
            :: |::..:|.:.||.:..      :.| .:.:.||...:.:||.:..||    ||.|.    |.
  Rat   189 RL-DMFEHISLMTLDSLQKCIFSFDSNC-QESNSEYIAAILELSSLIVKRQRQPFLYLD----FL 247

  Fly   216 YWLSSPFMRKRQNRLIKRLNDEHNNLMAMHQSQNQLKIENGLDIYQLRPIPLKDHKSLLEILLES 280
            |:|::...|.|     |..:..||...|:.:.:.......|:|.: |:..........:::||.:
  Rat   248 YYLTADGRRFR-----KACDVVHNFTDAVIRERRSTLNTQGVDEF-LKARAKTKTLDFIDVLLLA 306

  Fly   281 KDPQ---LTGEEICGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDELNLAQIKDQ---- 338
            ||..   |:..:|..|.:|..:.|:...:.||.:.|..:||:|..|::|..|:. ..::|:    
  Rat   307 KDEHGKGLSDVDIRAEADTFMFGGHDTTASALSWILYNLARHPEYQERCRQEVR-ELLRDREPEE 370

  Fly   339 -GW-DLEKLNYLDAVLHETMRLYPPQVIVGRQLKKDFPYTHSIVGDAE-LPCGSEIYINLYELQR 400
             .| ||.:|.:|...:.|::||:||.:::.|...:|.     ::.|.. :|.|:...|:::.:..
  Rat   371 IEWDDLAQLPFLTMCIKESLRLHPPVLLISRCCSQDI-----VLPDGRVIPKGNICVISIFGVHH 430

  Fly   401 NEVRYPKANHFDAQRF------LDSPPELLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPY 459
            |...:|....::..||      ..||...:.:|.|||.|..:.|:|..:|..||..|..|.|||.
  Rat   431 NPSVWPDPEVYNPFRFDPENPQKRSPLAFIPFSAGPRNCIGQTFAMSEIKVALALTLLRFCVLPD 495

  Fly   460 GDEVRLDLRLVLGSSNGFQLALKP 483
            ..|.|....|:|.:..|..|.::|
  Rat   496 DKEPRRKPELILRAEGGLWLRVEP 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 99/395 (25%)
Cyp4f6XP_006241111.1 p450 53..515 CDD:278495 102/408 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.