DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_663708.1 Gene:Cyp4x1 / 246767 RGDID:628719 Length:507 Species:Rattus norvegicus


Alignment Length:530 Identity:131/530 - (24%)
Similarity:221/530 - (41%) Gaps:100/530 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ICFCLA----SAFNYFRARRQRSLIKNLKGPFTWPLMGAMHKLL----FLTPINFFQRSTEYLTK 64
            :.||||    .|...: .|||| |:::|: ||..|   ..|.||    ||...| .::..|.:.:
  Rat    18 LVFCLALVLMQAVKLY-LRRQR-LLRDLR-PFPGP---TAHWLLGHQKFLQEDN-MEKLDEIVKE 75

  Fly    65 YGTFSRCWV-----FHRLFIP-LADLELSRQLLENDTHLETGYELMKDWLVGGVLMCQSEQWQKR 123
            |.....|||     |..::.| .|.:.|||    .|...:..::||..:|..|:|.....:|.:.
  Rat    76 YPCAFPCWVGPFQAFFYIYDPDYAKIFLSR----TDPKTQYLHQLMTPFLGRGLLNLDGPRWFQH 136

  Fly   124 HSLISGLFDKGNLEQLIDLSRHQTEQLLQKLAK--QADQKVFDIWYTVSPIVLDLMVMTTCGAKP 186
            ..|::..|.:..|:..:|:..|....:|.|..|  ...:...:::..::.:.||:::....|.:.
  Rat   137 RCLLTPAFHQDILKPCVDMMAHSVNMMLDKWEKTWTTQETTIEVFEHINLMTLDIIMKCAFGQET 201

  Fly   187 S-------EEYSKNLKDLSEIYRKRFLSLQSANRFNYWLSSPFMRKRQNRLIKRLNDEHNNLM-- 242
            :       |.|.|...:|.||...|.        :|:|        ..:.:|.:|:.:.:...  
  Rat   202 NCQINGTYESYVKATFELGEIISSRL--------YNFW--------HHHDIIFKLSPKGHCFQEL 250

  Fly   243 --AMHQSQNQLKIENGLDIYQLRPIPLKDH---------KSLLEILLESK---DPQLTGEEICGE 293
              .:||...:        |.|.|...|||.         ::.|:|:|.::   :...:..::..|
  Rat   251 GKVIHQCTEK--------IIQDRKKTLKDQVNQDDTQTSQNFLDIVLSAQAGDEKAFSDADLRSE 307

  Fly   294 LNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDELNLAQIKDQG----WD-LEKLNYLDAVLH 353
            :||..:.|:...:.::.:.|..:|.||..|.:|..|:.  .|...|    |: |:::.|....:.
  Rat   308 VNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIR--SILGDGSSITWEQLDEIPYTTMCIK 370

  Fly   354 ETMRLYPPQVIVGRQLKK--DFPYTHSIVGDAELPCGSEIYINLYELQRNEVRYPKANHFDAQRF 416
            ||:||.||...:.|:|.|  ..|..||      ||.|..:.::::.|..|...:.....||..||
  Rat   371 ETLRLIPPIPSISRELSKPLTLPDGHS------LPAGMTVVLSIWGLHHNPAVWKDPKVFDPLRF 429

  Fly   417 LDS------PPELLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPYGDEVR---LDLRLVLG 472
            ...      |...|.:|.|||.|..::|:|..||..:|..|..|.|.  .|..|   .....||.
  Rat   430 TKENSEQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALTLLRFRVA--ADLTRPPAFSSHTVLR 492

  Fly   473 SSNGFQLALK 482
            ..:|..|.||
  Rat   493 PKHGIYLHLK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 114/483 (24%)
Cyp4x1NP_663708.1 CYP4B-like 66..500 CDD:410771 108/471 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.