DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp316a1 and cyp-31A5

DIOPT Version :9

Sequence 1:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001343697.1 Gene:cyp-31A5 / 13198891 WormBaseID:WBGene00013381 Length:308 Species:Caenorhabditis elegans


Alignment Length:234 Identity:60/234 - (25%)
Similarity:109/234 - (46%) Gaps:20/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILTATFICFCLASAFNYFRARRQRSLIKNLKGPFTWPLMGAMHKLLFL-TPINFFQR--STEYL 62
            :|:.|..:......|:..::..|.|.::|:|..|.::|::|  |.|:.. .|..|..:  ...||
 Worm     3 VIIPAVLLASATVIAWLIYKHLRMRQVLKHLNQPRSYPIVG--HGLITKPDPEGFMNQVIGMGYL 65

  Fly    63 TKYGTFSRCWV--FHRLFIPLADLELSRQLLENDTHLETG--YELMKDWLVGGVLMCQSEQWQKR 123
            .........|:  |..|.:..||  |...:..:..||..|  |.|::.||...:|..|.|||:.:
 Worm    66 YPDPRMCLLWIGPFPCLMLYSAD--LVEPIFSSTKHLNKGFAYVLLEPWLGISILTSQKEQWRPK 128

  Fly   124 HSLISGLFDKGNLEQLIDLSRHQTEQLLQKLA--KQADQKVFDIWYTVSPIVLDLMVMTT----C 182
            ..|::..|....|:..:.:...|::.|:|||.  ..||::| |:...::...||::..|:    .
 Worm   129 RKLLTPTFHYDILKDFLPIFNEQSKILIQKLCCLGVADEEV-DVLSVITLCTLDIICETSMGKAI 192

  Fly   183 GAKPSE--EYSKNLKDLSEIYRKRFLSLQSANRFNYWLS 219
            ||:.:|  ||...:..::::..||..:....|.|.|.|:
 Worm   193 GAQLAENNEYVWAVHTINKLISKRTNNPLMWNSFIYNLT 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 53/202 (26%)
cyp-31A5NP_001343697.1 p450 36..>261 CDD:325183 53/201 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.