DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT33B and LamC

DIOPT Version :9

Sequence 1:NP_002270.1 Gene:KRT33B / 3884 HGNCID:6451 Length:404 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:399 Identity:111/399 - (27%)
Similarity:182/399 - (45%) Gaps:73/399 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    56 EKETMQFLNDRLASYLEKVRQLERDNAELE---NLIRERSQQQEPLLCPSYQSYFKTIEELQQKI 117
            |||.:|.||||||.|::::|.||.:|:.|.   ||.::...::...|...|:.......:|..: 
  Fly    46 EKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDE- 109

Human   118 LCSKSENARLVVQI-------------------------DNAKLAADDF-------------RTK 144
              :..|.|:|.:.|                         :||:|..:.:             |.|
  Fly   110 --TAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKK 172

Human   145 YQTEQSLRQLVESDINSLRRILDEL-------TLCRSDLEAQMESLKEELLSLKQNHEQEVNTLR 202
            :: :|:....:|::  .|||.||:|       ||.|.|||.|.:||:|||....|.|.||:...|
  Fly   173 FE-DQAKELALENE--RLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETR 234

Human   203 -------CQLGDRLNVEVDAAPAVDLNQVLNETRNQYEALVETNRREVEQWFATQTEELNKQVVS 260
                   .::..||:.:.:|    .|.|.|.|.|:|||..:..||.|:|..:..:.:.| |...:
  Fly   235 SRRQIEISEIDGRLSRQYEA----KLQQSLQELRDQYEGQMRINREEIELLYDNEIQNL-KAAAN 294

Human   261 SSEQLQSYQAEIIELRRT-VNALEIELQAQHNLRYSLENTLTESEARYSSQLSQVQSLITNVESQ 324
            .:.|..:...|.:.|.|| ::.|..:||...:....|...:.|.|....::..:....|.::|::
  Fly   295 RAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAE 359

Human   325 LAEIRSDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKL----PSNPCATTNACEKPIGSC 385
            |..:|.::..|.||||.|:|::..|:.||..|..||..|:.:|    |..|  ||::.....||.
  Fly   360 LQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRP--TTDSGISSNGSH 422

Human   386 VTNPCGPRS 394
            :|.....||
  Fly   423 LTASASSRS 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT33BNP_002270.1 Head 1..56 111/399 (28%)
Filament 55..366 CDD:306535 101/365 (28%)
Coil 1A 57..91 17/36 (47%)
Linker 1 92..102 1/9 (11%)
Coil 1B 103..203 36/151 (24%)
Linker 12 204..219 3/14 (21%)
Coil 2 220..363 42/143 (29%)
Tail 364..404 10/35 (29%)
LamCNP_001260974.1 Filament 45..401 CDD:278467 101/365 (28%)
ATP-synt_B <67..>142 CDD:304375 13/77 (17%)
MreC <178..>224 CDD:302802 19/47 (40%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.