DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and ADGRE5

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_510966.1 Gene:ADGRE5 / 976 HGNCID:1711 Length:835 Species:Homo sapiens


Alignment Length:240 Identity:50/240 - (20%)
Similarity:94/240 - (39%) Gaps:66/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 HPRLEDPNSIWILEHVYIPKSMPAVPQVG-TISMVGCILTIAVYLYIKKLRNLLGKCFICYVFCK 244
            |..:||    |         .:..:.:|| .:|:...:|.|..:|.::.::.......:....|.
Human   539 HYDVED----W---------KLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICL 590

  Fly   245 FVQYLIWAGGDLNLWNNI---CSL-AGYTNYFFALASHFWLSVMSHQIWKNLRLINRDERSYHFL 305
            ||...|:..|..|....:   |.| ||..:|.| ||:..|:|:      :.|.|        :||
Human   591 FVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCF-LAAFCWMSL------EGLEL--------YFL 640

  Fly   306 IYNIY-------------GWGTPAIMTAITYLVDWAWEDRPDKLNWIPGVGLYR-CWIN---TYD 353
            :..::             |:|.|.::..::..:            :..|.|..| ||::   .:.
Human   641 VVRVFQGQGLSTRWLCLIGYGVPLLIVGVSAAI------------YSKGYGRPRYCWLDFEQGFL 693

  Fly   354 WSAMIYLYGPMLILSLFNVVTFILTVNHIMKIKSSVKSSTQQQRK 398
            ||.:    ||:..:.|.|.|.|:.||..:.:..|.:....::.:|
Human   694 WSFL----GPVTFIILCNAVIFVTTVWKLTQKFSEINPDMKKLKK 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 4/15 (27%)
7tm_4 211..398 CDD:304433 43/207 (21%)
ADGRE5NP_510966.1 EGF_CA 64..99 CDD:284955
EGF_CA 116..>148 CDD:214542
EGF_CA 160..207 CDD:284955
EGF_CA 209..243 CDD:284955
GPS 493..536 CDD:280071
7tm_2 544..782 CDD:278432 48/235 (20%)
ProP 608..>785 CDD:223553 34/158 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 814..835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.