DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and ADGRE3

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_115960.2 Gene:ADGRE3 / 84658 HGNCID:23647 Length:652 Species:Homo sapiens


Alignment Length:337 Identity:77/337 - (22%)
Similarity:136/337 - (40%) Gaps:81/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 KRINPYLKITLEDGTIG--KYYLLTDMIVLRYEF----RYCEKVVSV------QEDQYKLYENGS 162
            |:...||...:....||  :...|:..:.|.::.    ...:||..|      |..|:.  .:|.
Human   259 KKDQVYLNSQVVSAAIGPKRNVSLSKSVTLTFQHVKMTPSTKKVFCVYWKSTGQGSQWS--RDGC 321

  Fly   163 FMIKPDVNWTLSKQWYCLH-----------PRLEDPNSIWILEHVYIPKSMPAVPQVG-TISMVG 215
            |:|..:.:.|:..   |.|           .:.|||             .:..:..|| ::|::.
Human   322 FLIHVNKSHTMCN---CSHLSSFAVLMALTSQEEDP-------------VLTVITYVGLSVSLLC 370

  Fly   216 CILTIAVYLYIKKLRNLLGKCFICYVFCKFVQYLIW-AGGDLNLWNNICS-LAGYTNYFFALASH 278
            .:|....:|..|.:||......:....|.|:.:|:: .|.|......:|| :||..:|.: ||:.
Human   371 LLLAALTFLLCKAIRNTSTSLHLQLSLCLFLAHLLFLVGIDRTEPKVLCSIIAGALHYLY-LAAF 434

  Fly   279 FWLSVMSHQIW---KNLRLINRD--ERSYHFLIYNIYGWGTPAIMTAITYLVDWAWEDRPDKLNW 338
            .|:.:....::   :||.::|..  .|...::::.: |:|.||:..||: ...|.          
Human   435 TWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPV-GYGVPAVTVAIS-AASWP---------- 487

  Fly   339 IPGVGLY----RCWINT---YDWSAMIYLYGPMLILSLFNVVTFILTVNHIMKIKSSVKSSTQQQ 396
                .||    |||::.   :.||.:    ||:..:...|:|.||| |..|:|.|   .||...:
Human   488 ----HLYGTADRCWLHLDQGFMWSFL----GPVCAIFSANLVLFIL-VFWILKRK---LSSLNSE 540

  Fly   397 RKCIQNNDFLLY 408
            ...|||...|.:
Human   541 VSTIQNTRMLAF 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 21/109 (19%)
7tm_4 211..398 CDD:304433 50/200 (25%)
ADGRE3NP_115960.2 EGF_CA 67..104 CDD:238011
GPS 304..344 CDD:280071 9/44 (20%)
7tm_4 353..594 CDD:304433 58/238 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.