DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and adgrg4a

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_021336868.1 Gene:adgrg4a / 793963 ZFINID:ZDB-GENE-121129-2 Length:1201 Species:Danio rerio


Alignment Length:272 Identity:57/272 - (20%)
Similarity:105/272 - (38%) Gaps:84/272 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 DPNSIWILEHVYIPKSMPAVPQVGTISMVGCIL-------TIAVYLYIKKLRN------------ 231
            :|...|:|.               .||.|||.:       |:..||..:|||.            
Zfish   867 NPKDEWVLT---------------IISYVGCGISSIFLGVTLLTYLAFEKLRRDYPSKILINLCM 916

  Fly   232 -LLGKCFICYVFCKFVQYLIWAGGDLNLW------NNIC-SLAGYTNYFFALASHFWLSVMSHQI 288
             |||...:..|               |.|      |.:| ::|.:.:||| ||:..|:.:.:..:
Zfish   917 ALLGLNMLFLV---------------NSWFASFNSNALCITVAAFQHYFF-LATFTWMGLGAINM 965

  Fly   289 WKNL-RLINRDERSYHFLIYNIYGWGTPAIMTAITYLVDWAWEDRPDKLNWIPGVGLYR-----C 347
            :..| ::.|....|| .|.:...|||.|..:..:...:|:      :.........|.:     |
Zfish   966 YLALVKVFNSYVPSY-ILKFCAVGWGIPLSVVILVLAIDF------NSYGTSLSTDLLQESTAFC 1023

  Fly   348 WINTYDWSAMIYLYGPMLILSLFNVVTFILTVNHIMKIKSSVKSSTQQQRKCIQNNDFLLYLR-- 410
            |... |.:..:.:....:::.:.|::.|::.:..|.|::.:..||:::        .||..||  
Zfish  1024 WFKN-DVTFYVTVVSFAILIMVCNIIVFVVVLVQIHKMRVNKPSSSRK--------GFLHDLRVV 1079

  Fly   411 --LSVMMGVTGI 420
              |:.::|:|.|
Zfish  1080 ASLTFLLGLTWI 1091

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 3/10 (30%)
7tm_4 211..398 CDD:304433 46/219 (21%)
adgrg4aXP_021336868.1 LamG 50..210 CDD:328935
HsdR <637..>729 CDD:333053
GPS 815..858 CDD:307782
7tmB2_GPR112 871..1138 CDD:320663 56/268 (21%)
TM helix 1 873..898 CDD:320663 8/39 (21%)
TM helix 2 908..930 CDD:320663 5/36 (14%)
TM helix 3 941..968 CDD:320663 7/27 (26%)
TM helix 4 983..999 CDD:320663 4/15 (27%)
TM helix 5 1028..1051 CDD:320663 2/22 (9%)
TM helix 6 1073..1098 CDD:320663 7/19 (37%)
TM helix 7 1102..1127 CDD:320663
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.