DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and Adgrf4

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001276428.1 Gene:Adgrf4 / 78249 MGIID:1925499 Length:698 Species:Mus musculus


Alignment Length:364 Identity:75/364 - (20%)
Similarity:124/364 - (34%) Gaps:106/364 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 IKPDVNWTLSKQWYCLHPRLEDPNSI---------WILEHV-------------------YIPKS 201
            :..|:|.|:..:  |.|.:.....||         .||.|:                   .|..|
Mouse   370 VMSDINSTVKCR--CRHTKAVTSFSILMSSKPVKNTILNHITFIGLSISIFSLVLCLVIEAIVWS 432

  Fly   202 MPAVPQVGTISMVGCILTIAVYLYIKKLRNLLGKCFICYV-----FCKFVQYLIWAGGDLNLWNN 261
            ...|.::..:..| ||:.|||.|....:..::|..|...|     :|..|.:|            
Mouse   433 RVVVTEISYMRHV-CIVNIAVSLLTANVWFIIGSNFSANVQEDHKWCVAVTFL------------ 484

  Fly   262 ICSLAGYTNYFFALASHFWLSVMSHQIWKNLRLI-------NRDERSYHFLIYNIYGWGTPAIMT 319
             |       :||.|:..||:      ::|.|.::       .|..:|....|....|:|.|.::.
Mouse   485 -C-------HFFFLSLFFWM------LFKALLIVYGILVVFRRMMKSRMMAIGFAIGYGCPLVIA 535

  Fly   320 AITYLVDWAWEDRPDKLNWIPGVGLYR---CWINTYDWSAMIYLYGPMLILSLFN-VVTFILTVN 380
            .||..|.            .||.|..|   ||:|.....|:.....|.|.:...| :|...:.:|
Mouse   536 VITVTVT------------EPGEGYTRKDACWLNWNQTKALFAFAIPALAIVAVNLLVVLAVAIN 588

  Fly   381 HIMKIKSSVKSSTQQQRKCIQNNDFLLYLRLS-------VMMGVTGISEVITYFVKRHKFWRQVL 438
            ....:..|.||           .|..:..|:|       .::|:|....:.|.....|..:..:.
Mouse   589 TQRPLIGSSKS-----------QDMAIVFRISKNVAILTPLLGLTWGFGLTTLLEGVHLVFHIIF 642

  Fly   439 RVPNFFHLGSGIVVF--VLFILKRSTFQMIMERISGPRR 475
            .:.|.|. |..|::|  ::....|...:|.:..:.|..|
Mouse   643 ALLNAFQ-GFFILLFGTIMDHKIRDALRMRVSSLKGKSR 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 10/59 (17%)
7tm_4 211..398 CDD:304433 46/202 (23%)
Adgrf4NP_001276428.1 GPS 351..394 CDD:366827 6/25 (24%)
7tm_GPCRs 402..669 CDD:391938 65/317 (21%)
TM helix 1 405..429 CDD:341315 2/23 (9%)
TM helix 2 444..465 CDD:341315 7/21 (33%)
TM helix 3 479..501 CDD:341315 9/47 (19%)
TM helix 4 522..538 CDD:341315 4/15 (27%)
TM helix 5 560..583 CDD:341315 5/22 (23%)
TM helix 6 606..631 CDD:341315 5/24 (21%)
TM helix 7 636..661 CDD:341315 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.