DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and Adgrd1

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_001070157.3 Gene:Adgrd1 / 689257 RGDID:1594795 Length:903 Species:Rattus norvegicus


Alignment Length:385 Identity:83/385 - (21%)
Similarity:141/385 - (36%) Gaps:74/385 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 LTENLKRINPYLKITLEDGTIGKYYLLTDMIVLRYEFRYC--------EKVVSVQEDQYKLYENG 161
            |::||.. :|.:.:.|......|.|:.......|. |.||        |.|.|.|         |
  Rat   502 LSQNLSG-SPLITVHLRHKLTQKQYVDATNESNRL-FLYCAFLNFSSGEGVWSSQ---------G 555

  Fly   162 SFMIKPDVNWTLSKQWYCLHPRLEDPNSIWILEHVYIPKSMPAVPQV--GTISMVGC-------- 216
            ..:.:.::.:::.   :|.|     ..:..||..| :|..:....||  .:||.|||        
  Rat   556 CALTEGNLTYSVC---HCTH-----LTNFAILMQV-VPLKLTLGHQVALSSISYVGCSLSVLCLA 611

  Fly   217 --ILTIAVYLYIKKLRNLLGKCFICYVFCKFV-QYLIWAGGDLNLWNNICSLAGYTNYFFALASH 278
              ::|.||...:..:||..........|...| |.|:.....:......|.:.....::|.|.:.
  Rat   612 ATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVLLLISFSMEPGTVPCQVLAVLLHYFFLTAF 676

  Fly   279 FWLSVMSHQIWKNLRLINRDERSYHFLIYNIYGWGTPAIMTAITYLVDWAWEDRPDKLNWIPGVG 343
            .|:.|....::..:..:...|.|.|...|.| |||.|.::..|:.      ....|..    |.|
  Rat   677 AWMLVEGLHLYSMVIKVFGSEDSKHLYYYGI-GWGCPLLICIISV------SSSMDSY----GTG 730

  Fly   344 LYRCWINTYDWSAMIYLY-GPMLILSLFNVVTFILTVNHIMKIKS-SVK-----SSTQQQRKCIQ 401
             ..||::..  |..|:.: ||.|::.:.|:|..:.....|..|.: |.|     |:.:...|.:.
  Rat   731 -DSCWLSVE--SGAIWAFVGPALLVIVVNIVILVAVTRVISHISTDSYKIHGDPSAFKLTAKAVA 792

  Fly   402 NNDFLLYLRLSVMMGVTGISEVITYFVKRHKFWRQVLRVPNFFHLGSGIVVFVLFILKRS 461
              ..|..|..|.:.||..:|:....|  ::.|        ...:...|:.:|:...|..|
  Rat   793 --VLLPILGTSWVFGVLAVSDRALVF--QYMF--------AILNSSQGLFIFLFHCLLNS 840

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 20/99 (20%)
7tm_4 211..398 CDD:304433 46/204 (23%)
Adgrd1XP_001070157.3 LamG <173..273 CDD:304605
GPS 539..579 CDD:280071 8/56 (14%)
7tm_4 595..831 CDD:304433 56/261 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.