DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and ADGRL4

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_071442.2 Gene:ADGRL4 / 64123 HGNCID:20822 Length:690 Species:Homo sapiens


Alignment Length:458 Identity:91/458 - (19%)
Similarity:161/458 - (35%) Gaps:157/458 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NLKRINPYLKITLEDG---------------------------TIGKYYLLTDMIVLR------- 138
            |:|.|:|::.:   ||                           :||.....:|..:|:       
Human   264 NMKHIHPHMNM---DGDYINIFPKRKAAYDSNGNVAVAFVYYKSIGPLLSSSDNFLLKPQNYDNS 325

  Fly   139 -YEFRYCEKVVSVQEDQYKLYENGSFMIKPDVNWTLSKQWYCL-HPRLED--------------- 186
             .|.|....|:||           |....|...:.|.|..:.| |.::.|               
Human   326 EEEERVISSVISV-----------SMSSNPPTLYELEKITFTLSHRKVTDRYRSLCAFWNYSPDT 379

  Fly   187 PNSIWILEHVYIPKS------------------MPAVPQVG--------TISMVG---------- 215
            .|..|..|...:..|                  |.:.|.:|        .|:.:|          
Human   380 MNGSWSSEGCELTYSNETHTSCRCNHLTHFAIL
MSSGPSIGIKDYNILTRITQLGIIISLICLAI 444

  Fly   216 CILTIAVYLYIKKLRNLLGKCFICYVFCKFVQYLIWAGGDLNLWNNICS-LAGYTNYFFALASHF 279
            ||.|...:..|:..|..:.|...|.:|...:.:|:  |.:.|.....|| :||..:||| ||:..
Human   445 CIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLV--GINTNTNKLFCSIIAGLLHYFF-LAAFA 506

  Fly   280 WLSVMSHQIWKNLRLINRDERSYHFLIYN---------IYGWGTPAIMTAITYLVDWAWEDRPDK 335
            |:.:....::  |.::.        :|||         |:|:.:||::...:..:.:.:      
Human   507 WMCIEGIHLY--LIVVG--------VIYNKGFLHKNFYIFGYLSPAVVVGFSAALGYRY------ 555

  Fly   336 LNWIPGVGLYR-CWI---NTYDWSAMIYLYGPMLILSLFNVVTFILTVNHIMKIKSSVK---SST 393
                  .|..: ||:   |.:.||    ..||..::.|.|::.|.:.:..:.:..:.:|   |..
Human   556 ------YGTTKVCWLSTENNFIWS----FIGPACLIILVNLLAFGVIIYKVFRHTAGLKPEVSCF 610

  Fly   394 QQQRKCIQNNDFLLYLRLSVMMGVTGISEVITYFVKRHKFWRQVLRVPNFFHLGSGIVVFV-LFI 457
            :..|.|.:....||:|     :|.|.|..|: :.|........:..|.|.|   .|:.:|: |.:
Human   611 ENIRSCARGALALLFL-----LGTTWIFGVL-HVVHASVVTAYLFTVSNAF---QGMFIFLFLCV 666

  Fly   458 LKR 460
            |.|
Human   667 LSR 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 25/139 (18%)
7tm_4 211..398 CDD:304433 44/213 (21%)
ADGRL4NP_071442.2 EGF_CA 58..>91 CDD:284955
GAIN 139..330 CDD:293098 11/68 (16%)
GPS 368..412 CDD:280071 4/43 (9%)
7tm_4 424..660 CDD:304433 58/273 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.