DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and adgrg11

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_017208200.1 Gene:adgrg11 / 563883 ZFINID:ZDB-GENE-041210-320 Length:793 Species:Danio rerio


Alignment Length:288 Identity:65/288 - (22%)
Similarity:113/288 - (39%) Gaps:76/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 NSIWILEHVYIPKSMPAVPQVGTISMVGCILTIAVYL--YIKKLRNLLGKCFICYVFCKFVQYLI 250
            ||:.:|.::::...|               |.:|...  |:.:.:|.:    :|.|...|:.|  
Zfish   546 NSVHVLINLFLALFM---------------LNVAFLTNEYVVQAQNSI----LCRVMAAFLHY-- 589

  Fly   251 WAGGDLNLWNNICSLAGYTNYFFALASHFWLSVMSHQIWKNLRLINRDERSYHFLIYNIYGWGTP 315
                        |.|:.:| :|...|.|..|     |:.|...|      .::.|...:.||..|
Zfish   590 ------------CLLSSFT-WFAVEALHLCL-----QMTKTATL------KHYLLKITVAGWAPP 630

  Fly   316 AIMTAITYLVDWAWEDR--PDKLNWIPGVGLYRCWI--NTYDWSAMIYLYGPMLILSLFNVVTFI 376
            |.:.::.:.:....||.  .:..|      :..|||  :|..:...|..|   ..:..|.:.|||
Zfish   631 AFVVSVIFSLGKYGEDNIMTESRN------VTMCWIVDSTVHYVVNIGYY---CFVFTFTLGTFI 686

  Fly   377 LTVNHIMKIKSSVKSST-QQQRKCIQNNDFLLYLRLSVMMGVT-GISEVITYFVKRHKFWRQVLR 439
            :.|..:..::.|..|.. :.:|.....:|....|.|..::|:| |||          .|....||
Zfish   687 VVVRWLSMLRMSKWSKDGKVKRSGTATSDISTMLGLCCLLGLTWGIS----------FFSYGALR 741

  Fly   440 VPNF--FHLGSGIVVFVLFI--LKRSTF 463
            :|::  |.:.:.:..|.||:  ||.|||
Zfish   742 MPSYYIFTILNSLQGFFLFVYYLKTSTF 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 3/8 (38%)
7tm_4 211..398 CDD:304433 39/193 (20%)
adgrg11XP_017208200.1 GPS 457..498 CDD:280071
7tm_4 511..759 CDD:304433 58/276 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.