DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and CG11318

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster


Alignment Length:300 Identity:61/300 - (20%)
Similarity:115/300 - (38%) Gaps:60/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 ISMVGCILTIAVYLYI-------KKLRN------LLGKCF-ICYVFCKFV--------QYLIWAG 253
            ||:|||.|::...|.|       |..|:      ||..|. :|.....||        :.|:..|
  Fly   504 ISIVGCSLSLLGILGIFLTAALFKSWRSQASTKVLLHLCLAMCLQMMLFVFLNTDDVSEALVVNG 568

  Fly   254 GDLNLWNNICSLAGYTNYFFALASHFWLSVMSH-QIWKNLRLINRDERSYHFLIYNIYGWGTPAI 317
            ..:.     |...|....:..|....|:.:::. |..:.:.:|..:....:.|...|..|..|.:
  Fly   569 NTVR-----CVALGAAMQYSILVLFSWMLIIAFLQFQRYVTVIGIERPPRYILKAAIVAWLLPLV 628

  Fly   318 MTAITYLVDWAWEDRPDKLNWIPG-------VGLYRCWINTYDWSAMIYLYGPMLILSLFNVVTF 375
            .|.:..|:|      ||  :::|.       .|:  |:.:.|.     .::|.:|.::|..|...
  Fly   629 PTLLVALID------PD--SYVPSAAQLSTDTGI--CYPSGYG-----LIFGVVLPVTLITVCNL 678

  Fly   376 ILTVNHIMKIKSSVKSSTQQQRKCIQNNDFLLYLRLSVMMGVTGISEVITYFVKRHKFWRQVLRV 440
            ::.|.....|..|:..|..:..|.:......|.:.|..::|:|.|..:..       |.:..:..
  Fly   679 VIFVYVFYSISHSLSQSIHKNEKKMVVKQIRLSIMLFFLLGLTWIFGIFA-------FMQAGVAF 736

  Fly   441 PNFFHLGS---GIVVFVLFILKRSTFQMIMERISGPRRQQ 477
            ...|.:.:   |.|:|:.|:|..||.:.:...:..|.:.:
  Fly   737 SYLFCITATMQGFVMFIYFVLLDSTNRRLWVGLICPTKME 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 45/216 (21%)
CG11318NP_651842.3 GPS 437..475 CDD:280071
7tm_4 500..750 CDD:304433 54/272 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462161
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.