DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and adgrl4

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_998532.2 Gene:adgrl4 / 406676 ZFINID:ZDB-GENE-040426-2689 Length:735 Species:Danio rerio


Alignment Length:290 Identity:66/290 - (22%)
Similarity:121/290 - (41%) Gaps:61/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 ILEHVYIPKSMPAVPQVG-TISMV---GCILTIAVYLYIKKLRNLLGKCFICYVFCKFVQYLIWA 252
            :|.|..:   :..:.|:| .||::   .||.|...:..|:..|..:.|...|.:|.....:||..
Zfish   465 LLAHYNV---LTRITQLGMVISLICLSMCIFTFWFFRDIQNTRTTIHKNLCCSLFMAQFIFLIGI 526

  Fly   253 GGDLNLWNNICSL-AGYTNYFFALASHFWLSVMSHQIWKNLRLINRDERSYHFLIYN-------- 308
            ....:.|  .||| ||..:||| ||:..|:.:....::  |.::.        :|||        
Zfish   527 NKSAHKW--FCSLIAGLLHYFF-LAAFAWMCIEGIHLY--LIVVG--------VIYNKGFLHRNF 578

  Fly   309 -IYGWGTPAIMTAITYLVDWAWEDRPDKLNWIPGVGLYRCWI---NTYDWSAMIYLYGPMLILSL 369
             .:|:|:||::.||:..:.:.:......           ||:   |.:.||    ..||.:::.|
Zfish   579 YAFGYGSPAVVVAISATLGYKYYGTSSV-----------CWLSTENNFIWS----FIGPAILIIL 628

  Fly   370 FNVVTFILTVNHIMK---IKSSVKSSTQQQRKCIQNNDFLLYLRLSVMMGVTGISEVITYFVKRH 431
            .|::.|.:.:..:.:   :|....|..:..|.|.:....||:     ::|||....|: |.:...
Zfish   629 VNLLAFAVIIYKVYRHTAVKKPEISHYENIRSCARGAIALLF-----VLGVTWAFGVM-YILYET 687

  Fly   432 KFWRQVLRVPNFFHLGSGIVVFV-LFILKR 460
            .....:....|.|   .|:.:|: |.:|.|
Zfish   688 TLTAYLFTFANVF---QGMFIFIFLCVLSR 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 2/4 (50%)
7tm_4 211..398 CDD:304433 46/205 (22%)
adgrl4NP_998532.2 EGF_CA 34..56 CDD:304395
EGF_CA 60..93 CDD:238011
EGF_CA 110..143 CDD:214542
GAIN 188..386 CDD:293098
GPS 416..457 CDD:280071
7tm_4 469..705 CDD:304433 60/275 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.