DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and Dh44-R2

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_610789.3 Gene:Dh44-R2 / 36368 FlyBaseID:FBgn0033744 Length:476 Species:Drosophila melanogaster


Alignment Length:420 Identity:85/420 - (20%)
Similarity:143/420 - (34%) Gaps:159/420 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GKYYLLTDMIVLRYEFRYCEKVVSVQEDQYKLYE-----NGSFMIKPDVNWTLSKQWYCLHPRLE 185
            |.:|..||...     |:|  ..:...|.|..|:     :||..:.||.:           |.:|
  Fly   113 GVHYDTTDNAT-----RFC--FPNGTWDHYSDYDRCHQNSGSIPVVPDFS-----------PNVE 159

  Fly   186 DPNSIWILEHVYIPKSMPAVPQVG--TISMVGCILTIAVYLYIKKLR----NLLGKCFICYVFCK 244
                            :||:...|  .:|....::.:.::|..|.||    .:....|:.|:   
  Fly   160 ----------------LPAIIYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYI--- 205

  Fly   245 FVQYLIWAGGDLNLWNNI----CSLAGYTN-----YFFALASHFWLSVMSHQIWK-NLRLINRDE 299
             ...|:|.   |.|:..:    .|.||...     .:|.|.:.||:.|....::. .::..:.|.
  Fly   206 -TSALLWI---LTLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDN 266

  Fly   300 RSYHFLIYNIYGWGTPAIMTAITYL-----------------VDWAWEDRPDKLNWIPGVGLYRC 347
            .|  |:||.:.|||.||:...:..:                 :|.||. |...::||..|     
  Fly   267 IS--FIIYALIGWGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWM-RESHIDWIFKV----- 323

  Fly   348 WINTYDWSAMIYLYGPMLILSLFNVVTFILTVNHIM--KIKSSVKSSTQQQRKCIQNNDFLLYLR 410
                           |..:..|.|:| |::.:..::  |::|:....|:|..|..:     ..|.
  Fly   324 ---------------PASLALLVNLV-FLIRIMWVLITKLRSAHTLETRQYYKASK-----ALLV 367

  Fly   411 LSVMMGVT----------GIS----EVITYFV----------------------KRHKF--WRQV 437
            |..:.|:|          |||    |.|..|:                      .||.|  ||:.
  Fly   368 LIPLFGITYLLVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWRES 432

  Fly   438 LRVPNFFHLGSGIVVFVLFILKRSTFQMIM 467
            ..:    |..|.       |..|||.:.::
  Fly   433 RNI----HRNSS-------IKNRSTEECVI 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 15/75 (20%)
7tm_4 211..398 CDD:304433 45/219 (21%)
Dh44-R2NP_610789.3 HRM 82..144 CDD:280888 9/37 (24%)
7tm_2 159..407 CDD:278432 60/299 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462247
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.