DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and Cirl

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001260807.1 Gene:Cirl / 35846 FlyBaseID:FBgn0033313 Length:1711 Species:Drosophila melanogaster


Alignment Length:313 Identity:53/313 - (16%)
Similarity:96/313 - (30%) Gaps:131/313 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 ISMVGCILTIAVYLYIKKLRN----------LLGKCFICY-----------------VFCKFVQY 248
            ||:..|::.|.:.|...||.|          :....::|.                 :||.|:..
  Fly   772 ISIGICVVFIVIALLTLKLFNGVFVKSARTSIYTSIYLCLLAIELLFLLGIEQTETSIFCGFITI 836

  Fly   249 LIWAGGDLNLWNNICSLAGYTNYFFALASHFWLSVMSHQIWKNLRLINRDE----RSYHFLIYNI 309
            .:.           |::...|.:|...|.|.:.::.|.::     |:..|:    ..|:.|.|  
  Fly   837 FLH-----------CAILSGTAWFCYEAFHSYSTLTSDEL-----LLEVDQTPKVNCYYLLSY-- 883

  Fly   310 YGWGTPAIMTAITYLVDWAWEDRPDK------------------------------LNWI----- 339
               |....:.||:.::|.:...:.|.                              |:||     
  Fly   884 ---GLSLSVVAISLVIDPSTYTQNDYCVLMEANALFYATFVIPVLVFFVAAIGYTFLSWIIMCRK 945

  Fly   340 PGVGL--------------YRC-----------WINTY---------DWSAMIYLYGPMLILSLF 370
            ...||              .||           |.:.|         |.:|.:|.|..:...:|.
  Fly   946 SRTGLKTKEHTRLASVRFDIRCSFVFLLLLSAVWCSAYFYLRGAKMDDDTADVYGYCFICFNTLL 1010

  Fly   371 NVVTFILTVNHIMKIKSSVKSSTQQQR---KCIQNNDFLLYLRLSVMMG-VTG 419
            .:..|:.......||:...:...:|..   ||::.:      :.|:..| |||
  Fly  1011 GLYIFVFHCIQNEKIRREYRKYVRQHAWLPKCLRCS------KTSISSGIVTG 1057

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 46/289 (16%)
CirlNP_001260807.1 Gal_Lectin 33..113 CDD:280328
GAIN 453..680 CDD:293098
GPS 705..752 CDD:197639
7tm_4 763..1014 CDD:304433 42/262 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462227
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.