DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and ADGRD2

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001382354.1 Gene:ADGRD2 / 347088 HGNCID:18651 Length:982 Species:Homo sapiens


Alignment Length:339 Identity:69/339 - (20%)
Similarity:125/339 - (36%) Gaps:89/339 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 YCLHPRLEDPNSIWILEHVY-IPKSMPAVPQVGTISMVG-----CILTIAVYLYI-----KKLRN 231
            :|.|     ..|..||..:| :.:.......:.|:|.||     |.||....|::     |..|.
Human   669 FCNH-----STSFAILLQIYEVQRGPEEESLLRTLSFVGCGVSFCALTTTFLLFLVAGVPKSERT 728

  Fly   232 LLGKCFICYVFCKFVQYLI---WAGGDLNLWNNI-CSLAGYTNYFFALASHFWLSVMSHQIWKNL 292
            .:.| .:.:.......:|:   ||..     |.: |.......:|..|.:..|:.|....:|:.:
Human   729 TVHK-NLTFSLASAEGFLMTSEWAKA-----NEVACVAVTVAMHFLFLVAFSWMLVEGLLLWRKV 787

  Fly   293 RLINRDERSYH----FLIYNIYGWGTPAIMTAITYLV---DWAWEDRPDKLNWIPGVGLYRCWIN 350
            ..:     |.|    ..:|:..|||.|..:.|:|..:   |:.          .||    .||:|
Human   788 VAV-----SMHPGPGMRLYHATGWGVPVGIVAVTLAMLPHDYV----------APG----HCWLN 833

  Fly   351 TYDWSAMIYLYGPMLILSLFNVVTFILTVNHIM---KIKSSVKSSTQQQR-----KCIQNNDFLL 407
            .:. :|:....||:|         |:||.|..:   .:..:|.|:.::.|     .|:|..   :
Human   834 VHT-NAIWAFVGPVL---------FVLTANTCILARVVMITVSSARRRARMLSPQPCLQQQ---I 885

  Fly   408 YLRL-------SVMMGVTGISEVITYFVKRHKFWRQVLRVPNFFHLGSGIVVFVLFIL----KRS 461
            :.::       .|::.|.|::.:....|.....|.......|..   .|:.:|:::..    .||
Human   886 WTQIWATVKPVLVLLPVLGLTWLAGILVHLSPAWAYAAVGLNSI---QGLYIFLVYAACNEEVRS 947

  Fly   462 TFQMIMER--ISGP 473
            ..|.:.|:  ..||
Human   948 ALQRMAEKKVAEGP 961

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 5/18 (28%)
7tm_4 211..398 CDD:304433 46/215 (21%)
ADGRD2NP_001382354.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.