DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and adgrg1

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001018317.1 Gene:adgrg1 / 324948 ZFINID:ZDB-GENE-030131-3671 Length:648 Species:Danio rerio


Alignment Length:445 Identity:87/445 - (19%)
Similarity:153/445 - (34%) Gaps:153/445 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IIPAHLTGLYTFRQLADGSQEPVKSHLRACICKLKPCIRFCCPRNKMMPNSRCSDGLTENLKRIN 113
            ||...|.|.|.|    ||      :|:.   ||.|     .|...::.|  |.::.:.|.:.|.|
Zfish   153 IITGDLKGNYIF----DG------AHIN---CKEK-----FCDEARLKP--RGANMIEEVVMRFN 197

  Fly   114 PYLKITL---------------------------EDGTIGKYYLLTDMIVLRYEFRYCEKVVSVQ 151
            ...::.|                           :..||...|:.:.   ||...|...|||...
Zfish   198 AKGRVDLPCAQGTVIEMDEEFTGHNFTVPAPRFVDANTIPSVYIPSS---LRSVSRRKSKVVCTY 259

  Fly   152 EDQYKLYENGSF--------------------MIKP---------------------------DV 169
            .....|:|.|..                    :|:|                           :|
Zfish   260 YKNKTLFERGPSKSALLDDIVGLSVENETIRNLIEPVKIRFHHRPFAPDSSGRCVSWDTKQDNEV 324

  Fly   170 NW------TL-----SKQWYCLH-------PRLEDPNSIWILEHVYIPKSMPAVPQVG-TISMVG 215
            ||      |:     ..:.:|.|       .::|..:::   .|:   |::..:..|| .:|:|.
Zfish   325 NWKDDGCDTVKINEEQTECHCNHLTYFAILVQVEQKSTV---RHL---KALTFITAVGCAVSLVS 383

  Fly   216 CILTIAVYLYIKKLR------NLLGKCFICYVF--CKFVQYLIWAGGDLNLWN-NICSLAGYTNY 271
            |:  :..|...|:.|      :|:.:..:..:|  |.|   .|..|...|:.| .:|.|.|...:
Zfish   384 CL--VLFYWLCKRRRGKKNQISLVHRGLVVAIFLLCLF---FILTGILANVANETVCQLTGSLLH 443

  Fly   272 FFALASHFWLSVMSHQIWKNLRLINRDERS-YHFLIYNIYGWGTPAIMTAITYLVDWAWEDR--- 332
            :..|::..|   |:.:::....|:.:...| ....|:.:.|:|.|.::.:|...|...:.:|   
Zfish   444 YGLLSTLCW---MAMEVFHTFLLVRKVFNSPLPIWIFYLMGFGFPFLLVSILLSVGDIYGERKIK 505

  Fly   333 -PDKLNWIPGVGLYR-CWINTYDWSAM---IYLYGPMLILSLFNVVTFILTVNHI 382
             .|.:|     ..|| ||:...|.|.:   |...|.:.::....:|...|.|..|
Zfish   506 PSDDVN-----NPYRMCWMTEGDKSQLAHYIINIGLLAVVVSSGLVMLFLVVREI 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 41/239 (17%)
7tm_4 211..398 CDD:304433 43/190 (23%)
adgrg1NP_001018317.1 GPS 312..354 CDD:280071 6/41 (15%)
7tm_4 369..611 CDD:304433 45/200 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.