DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and mthl15

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_723538.3 Gene:mthl15 / 318914 FlyBaseID:FBgn0051720 Length:718 Species:Drosophila melanogaster


Alignment Length:456 Identity:129/456 - (28%)
Similarity:204/456 - (44%) Gaps:86/456 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GSQEPVKSHLRAC----ICKLKPCIRFCCPRNKMMPNSRCSDGLTENLKRINPYLKITLEDGTIG 126
            |:....|..:|||    ||:..||||.||...:|......|           .|.||   |||..
  Fly   238 GALPEQKFLVRACQEMKICQKIPCIRRCCAEGEMYAKGNFS-----------TYCKI---DGTDF 288

  Fly   127 KYYLLTDMIVLRYEFR-----------YCEKV----VSVQEDQYKLY-ENGSFMIKPDVNWTLSK 175
            |:....::.: ...|.           .|.|.    .:..:|.:.:. .|||.:|..... |.:.
  Fly   289 KFEGFQNLNI-NANFSKPSDFGIVHGLQCPKFRLDPDNFPDDSHTINPSNGSLIIHNTFK-TYTN 351

  Fly   176 QWYC---------LHPRLEDPNSIWILEHVYIPKSMPAVPQVGTISMVGC---ILTIAVYLYIKK 228
            ..||         |:..|...|.:...:.:.. |..|    :|.  ::.|   .||:.||:.|.|
  Fly   352 TQYCVERVRPNQKLYTFLCFDNKVVTGDRIRF-KMYP----IGL--LISCCFYALTLIVYISIAK 409

  Fly   229 LRNLLGKCFICYVFCKFVQYLIWAGGDLNLWNN--ICSLAGYTNYFFALASHFWLSVMSHQIWK- 290
            ||||.||..||.|...|..||..|.|.|...:|  ||.|:|:..||..:|:..|:::.|..||| 
  Fly   410 LRNLPGKILICLVSSLFAAYLGIALGQLRPTSNDDICFLSGFFVYFCLMAAFSWMNITSFDIWKT 474

  Fly   291 ----NLRLINRDERSYHFLIYNIYGWGTPAIMTAITYLVDWAWED-RPDKLNWIPGVGLYRCWIN 350
                .|:...:.:....|:.|:.||||.|.::|.||  :.:...| .||.:.  |..|..|||. 
  Fly   475 FGSTKLKSCEKSDLRRQFIWYSCYGWGLPTLLTGIT--IAFTKSDILPDAVR--PNFGHGRCWF- 534

  Fly   351 TYD---WSAMIYLYGPMLILSLFNVVTFILTVNHIMKIKSSV-------KSSTQQQRKCIQNND- 404
            |||   .:::::..||:.||.:.|:|.|:||:.:..|:|:.:       ......:|:..|:.. 
  Fly   535 TYDSFGSASLLFFSGPVGILFIINLVLFVLTMKYCNKVKNEIYKMQSLNSDKPVLKRRFFQDKTR 599

  Fly   405 FLLYLRLSVMMGVTGISEVITYFVKRHK---FWRQVLRVPNFFHLGSGIVVFVLFILKRSTFQMI 466
            |::..:|..:||:|.:.|:::.....||   ||    .:.:.|::..||.||::|:.||..:..|
  Fly   600 FVMNTKLCFVMGITWLLEIVSILFYDHKKTFFW----TISDSFNVLLGIFVFIIFVFKRRIYNEI 660

  Fly   467 M 467
            |
  Fly   661 M 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 36/159 (23%)
7tm_4 211..398 CDD:304433 68/207 (33%)
mthl15NP_723538.3 Mth_Ecto <247..355 CDD:299804 29/123 (24%)
7tm_4 385..646 CDD:304433 85/275 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I4416
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5395
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 1 1.000 - - FOG0003851
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.