DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and Adgrf2

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_017452241.2 Gene:Adgrf2 / 301269 RGDID:1306718 Length:654 Species:Rattus norvegicus


Alignment Length:432 Identity:75/432 - (17%)
Similarity:144/432 - (33%) Gaps:156/432 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PRNKMMPNSRCSDGLTENLKRINPYLKITLED------------------GTIGKYYLLTDM--- 134
            |||.:..|...|..:.:...::...:.:|.|:                  |.|.:..||.:|   
  Rat   237 PRNSLGKNFTFSMRVNDTSDKVTGRILLTTEELQKVPSAFQVISIAFPTLGAILEASLLENMTVN 301

  Fly   135 -----IVLRYEFRYCEKVVSVQEDQYKLYENGSFMIKPDVNWTLSKQWYCLHPRLE--------- 185
                 ::|..|.:   .:..:.|...|..|..|..:          .|:.|..|.:         
  Rat   302 GLVLSVILPKELK---NISLIFEKIRKSGERKSQCV----------GWHSLESRWDRRACKMIQE 353

  Fly   186 ---------DPNSIWILEHVYIPKSMPAVPQVGTISMVGCILTIAVYLYIKKLRNLLGKCFICYV 241
                     .||..:....:.:..:....|.:..|:.:|                 ||......:
  Rat   354 NSRQAICRCQPNKFFTSFSILMSPNTVESPVLTYITYIG-----------------LGISICSLI 401

  Fly   242 FCKFVQYLIWAGGD---------------------LNLW-------------NNICSLAGYTNYF 272
            .|..::.|:|:...                     .::|             :|.|..|.:..:|
  Rat   402 ICLAIEALVWSQVTKTEISYLRHLCIANIAVTLLMADVWFIVASFLSGPIVHHNGCVTATFFVHF 466

  Fly   273 FALASHFWLSVMSHQIWKNLRLINRDERSYH-----FLIYNIY--GWGTPAIMTAITYLVDWAWE 330
            |.|:..||:...:..|...:.::      :|     .|:.:::  |:|.|.::..||..|.    
  Rat   467 FYLSVFFWMLAKALLILYGILIV------FHTLPKSCLVASLFTVGYGCPLVIAVITLAVT---- 521

  Fly   331 DRPDKLNWIPGVGLYR---CWINTYDWSAMIYLYGPMLILSLFNVVTFILTVNHIMKIKSSVKSS 392
                    .||.|..|   ||:|.....|::....|.|.:.:.|::|..|.:  |...:::|.||
  Rat   522 --------EPGKGYLRPEACWLNWDMTKALLAFVVPALAIVVVNLITVTLVI--IKTQRAAVGSS 576

  Fly   393 TQQQRKCIQNNDFLLYLR-------LSVMMGVT---GISEVI 424
            ..|:.:.|        :|       |:.::|:|   ||:.|:
  Rat   577 MFQEVRAI--------VRICKNIAILTPLLGLTWGFGIATVV 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 23/149 (15%)
7tm_4 211..398 CDD:304433 43/230 (19%)
Adgrf2XP_017452241.2 GPS 330..377 CDD:413374 6/56 (11%)
7tm_GPCRs 382..628 CDD:421689 52/274 (19%)
TM helix 1 384..409 CDD:410628 5/41 (12%)
TM helix 2 424..446 CDD:410628 1/21 (5%)
TM helix 3 458..485 CDD:410628 7/26 (27%)
TM helix 4 499..519 CDD:410628 5/19 (26%)
TM helix 5 539..568 CDD:410628 7/30 (23%)
TM helix 6 584..610 CDD:410628 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.