DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and Adgrf3

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_006239862.1 Gene:Adgrf3 / 298857 RGDID:1305868 Length:992 Species:Rattus norvegicus


Alignment Length:442 Identity:82/442 - (18%)
Similarity:154/442 - (34%) Gaps:129/442 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LKRINPYLKITLEDGTIGKYYLLTDMIVLRYEFRYCEKVVSVQEDQYKLYENGSFMIKPDVNWTL 173
            |::::..|......|.....|....||:          |:|:..|.....:....|...|:|.||
  Rat   580 LQKLDSRLPSNYRQGLRDTSYATPGMIL----------VISITADGQDFTQAEVIMDFEDMNGTL 634

  Fly   174 -----------------------------SKQWYCLHPRLEDPNSIWILEHVYIPKSMPAVPQVG 209
                                         :.|..|.|   ....||.:.:|     ::|..|.:.
  Rat   635 HCVFWDHNAFQGRGGWSDEGCELQAANASAVQCVCRH---LTAFSILMSQH-----AVPEDPLLD 691

  Fly   210 TISMVG---CILTIAVYLYIKKL------RNLLG----KCFICYVFCKFVQYLIWAGGDLNLW-- 259
            .:|.||   .||.:.|.|.|.:|      ||.:.    ......|.|..|....:.|   |.|  
  Rat   692 LLSQVGVGASILALLVCLVIYRLVWRVVVRNKVAFFRHTALFNMVICLLVADTCFLG---NPWLP 753

  Fly   260 ----NNICSLAGYTNYFFALASHFWL----SVMSHQIWKNLRLINRDERSYHFLIYNIYGWGTPA 316
                :.:|....:..:||.||:.||:    .|::||:   |.:.::..:.....:.:|.|:..|.
  Rat   754 SGYHSLVCLATAFLCHFFYLATFFWMLAQALVLAHQL---LFVFHQLSKPLVLSMMSILGYLCPL 815

  Fly   317 IMTAITYLVDWAWEDRPDKLNWIPGVGLY----------RCWINTYDWSAMIYLYGPMLILSLFN 371
            ....:|                   :|||          :|.::. |..::.....|:|.:...|
  Rat   816 GFAGVT-------------------LGLYLPQRKYLREGKCLLSG-DGVSLHAFSEPVLAIVSVN 860

  Fly   372 VVTFILTVNHIMKIKSSVKSSTQQQRKCIQNNDFLLYLR----LSVMMGVTGISE--VITYFVKR 430
            .:..::.|..:::...|...:.::::..:.....||.|.    |:..:|||.:.|  ::.:::  
  Rat   861 GLVLVIAVLKLLRPSLSEGPAVEKRQALVGVLKALLILTPIFGLTWGLGVTTLFEGSLVFHYI-- 923

  Fly   431 HKFWRQVLRVPNFFHLGS--GIVVFVLFIL-KRSTFQMIMERISGPRRQQPA 479
                        |..|.|  |:.:||...| .:...:.:.:.:.|.|....|
  Rat   924 ------------FVILNSLQGVFIFVFGCLTDKKVLEALRKWLRGSRSSNSA 963

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 20/116 (17%)
7tm_4 211..398 CDD:304433 42/219 (19%)
Adgrf3XP_006239862.1 HRM 353..>395 CDD:295297
GPS 632..679 CDD:197639 7/49 (14%)
7tm_4 687..935 CDD:304433 55/287 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.