Sequence 1: | NP_788473.1 | Gene: | mthl6 / 38839 | FlyBaseID: | FBgn0035789 | Length: | 480 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001317426.1 | Gene: | ADGRD1 / 283383 | HGNCID: | 19893 | Length: | 906 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 44/204 - (21%) |
---|---|---|---|
Similarity: | 78/204 - (38%) | Gaps: | 28/204 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 198 IPKSMPAVPQV--GTISMVGC----------ILTIAVYLYIKKLRNLLGKCFICYVFCKFV-QYL 249
Fly 250 IWAGGDLNLWNNICSLAGYTNYFFALASHFWLSVMSHQIWKNLRLINRDERSYHFLIYNIYGWGT 314
Fly 315 PAIMTAITYLVDWAWEDRPDKLNWIPGVGLYRCWINTYDWSAMIYLY-GPMLILSLFNVVTFILT 378
Fly 379 VNHIMKIKS 387 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mthl6 | NP_788473.1 | Mth_Ecto | 25..197 | CDD:119403 | |
7tm_4 | 211..398 | CDD:304433 | 41/189 (22%) | ||
ADGRD1 | NP_001317426.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4193 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |