DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and ADGRD1

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001317426.1 Gene:ADGRD1 / 283383 HGNCID:19893 Length:906 Species:Homo sapiens


Alignment Length:204 Identity:44/204 - (21%)
Similarity:78/204 - (38%) Gaps:28/204 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 IPKSMPAVPQV--GTISMVGC----------ILTIAVYLYIKKLRNLLGKCFICYVFCKFV-QYL 249
            :|..:....||  .:||.|||          ::|.||...:..:||..........|...| |.|
Human   586 VPLELARGHQVALSSISYVGCSLSVLCLVATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVL 650

  Fly   250 IWAGGDLNLWNNICSLAGYTNYFFALASHFWLSVMSHQIWKNLRLINRDERSYHFLIYNIYGWGT 314
            :.....|......|.:.....::|.|::..|:.|....::..:..:...|.|.|...|.: |||.
Human   651 LLISFRLEPGTTPCQVMAVLLHYFFLSAFAWMLVEGLHLYSMVIKVFGSEDSKHRYYYGM-GWGF 714

  Fly   315 PAIMTAITYLVDWAWEDRPDKLNWIPGVGLYRCWINTYDWSAMIYLY-GPMLILSLFNVVTFILT 378
            |.::..|:  :.:|.:......|         ||::..  |..|:.: .|.|.:.:.|:...|..
Human   715 PLLICIIS--LSFAMDSYGTSNN---------CWLSLA--SGAIWAFVAPALFVIVVNIGILIAV 766

  Fly   379 VNHIMKIKS 387
            ...|.:|.:
Human   767 TRVISQISA 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 41/189 (22%)
ADGRD1NP_001317426.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.