DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and CG15744

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_572870.2 Gene:CG15744 / 2768909 FlyBaseID:FBgn0030466 Length:1797 Species:Drosophila melanogaster


Alignment Length:415 Identity:79/415 - (19%)
Similarity:135/415 - (32%) Gaps:146/415 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ISHIPKLN-----DSYAYEELIIPAHLTGLYTFRQ-----LADGSQEPVKSHLRACICKLKPCIR 87
            ::|:.||.     .|:.||.           ||.|     |.|.|..|:     ||.|.|...|.
  Fly   131 LAHLEKLKLAGNAISHIYEG-----------TFDQMPKLKLLDLSGNPL-----ACDCGLIWLIA 179

  Fly    88 FCCPRN-KMMPNSRC-SDGLTENLKRINPYLKITLEDGTIGKYYLLTDMIVLRYEFRYCEKVVS- 149
            :...|. ::.|..:| |.|   |.:.: |..|:     .:||.:             :||.::. 
  Fly   180 WSSSREVRLQPPPKCESPG---NFRGM-PLKKL-----RVGKDF-------------HCETLLQP 222

  Fly   150 ----VQEDQYKLYENGSFMIKPDVNWTLSKQWYCLHPRLEDPNSIWILEHVYIPKSMPAVPQVGT 210
                :.......:|.....:|            |..||:.          :.:|:....:|....
  Fly   223 LLELIPSQNQVAFEGDELQLK------------CHAPRVA----------IGVPRESEDLPTKAY 265

  Fly   211 ISMVGCILTIAVYLYIKKLRNLLGKCFICY-----VFCKFVQYLIWAGGDLNLWNNICSLAGYTN 270
            :          .:.:.:|:|.......|.|     ||           ||:||.....:.:|...
  Fly   266 V----------FWGWSEKIRAKNSTEDIIYQDPTKVF-----------GDVNLETRHSTDSGILQ 309

  Fly   271 YFFALAS----H--FW------------LSVMSHQIWK-----NLRLINRDERSYHFLIYNIYGW 312
            ....:||    |  .|            .:::.|.:.|     ..|:::.::.:||        |
  Fly   310 SILRIASLTQNHTGMWDCTLRSQQANLSQAIVLHVVAKGTLYCEARVVHTNKGTYH--------W 366

  Fly   313 GTPAIMTAITYLVDWAWEDRPDKLNWIPGVGLYRC-----WINTYDWSAMIYLYGPMLILSLFNV 372
              |..|...|.|.:.. |:..|...  .....:.|     |:| .|..:.:|:.....||..|..
  Fly   367 --PRTMRGETVLQECV-EEPSDATQ--ARRASHECGPSGEWLN-LDTESCVYVSETTRILEQFAK 425

  Fly   373 VTFILTV-NHIMKIKSSVKSSTQQQ 396
            |...||. .:.::|...:.:.||.|
  Fly   426 VNLTLTKGQNALEIARRLHNFTQAQ 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 35/180 (19%)
7tm_4 211..398 CDD:304433 42/220 (19%)
CG15744NP_572870.2 LRR_8 107..168 CDD:290566 12/47 (26%)
LRR_4 107..147 CDD:289563 4/15 (27%)
leucine-rich repeat 109..133 CDD:275378 0/1 (0%)
leucine-rich repeat 134..157 CDD:275378 8/33 (24%)
LRRCT 166..216 CDD:214507 16/76 (21%)
IG_like 229..344 CDD:214653 22/157 (14%)
HRM <366..412 CDD:295297 11/51 (22%)
7tm_4 768..>975 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.