DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and Adgrg2

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_852031.1 Gene:Adgrg2 / 266735 RGDID:628618 Length:1013 Species:Rattus norvegicus


Alignment Length:248 Identity:63/248 - (25%)
Similarity:105/248 - (42%) Gaps:52/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 PKSMPAVPQVGTISMVGCIL-------TIAVYLYIKKL-RNLLGKCFICYVFCKFVQYLIWAGGD 255
            |..|.|:.   .|:.:||.|       |:..|:..:|: |:...|..|.......:..|::.   
  Rat   618 PSQMMALT---FITYIGCGLSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALLLLNLVFL--- 676

  Fly   256 LNLW------NNIC-SLAGYTNYFFALASHFWLSVMS-HQIWKNLRLINRDERSYHFLIYNIYGW 312
            |:.|      ...| |:|.:.:||. |.|..|:.:.: |.....:::.|...|.| .|.:.|.||
  Rat   677 LDSWIALYNARGFCISVAVFLHYFL-LVSFTWMGLEAFHMYLALVKVFNTYIRKY-ILKFCIVGW 739

  Fly   313 GTPAIMTAITYLVDWAWEDRPDKLNWIPGVGLYR----------CWINTYDWSAMIYL--YGPML 365
            |.||::.:|...:.      ||..    |:|.|.          ||||:   |.:.|:  .|...
  Rat   740 GIPAVVVSIVLTIS------PDNY----GIGSYGKFPNGTPDDFCWINS---SVVFYITVVGYFC 791

  Fly   366 ILSLFNVVTFILTVNHIMKIKSSVKSSTQQQRKCIQNNDFLLYLRLSVMMGVT 418
            ::.|.||..||:.:..:.:||.. |....|::..||  |......|:.::|:|
  Rat   792 VIFLLNVSMFIVVLVQLCRIKKK-KQLGAQRKTSIQ--DLRSIAGLTFLLGIT 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 54/214 (25%)
Adgrg2NP_852031.1 GPS 566..608 CDD:280071
7tm_4 621..871 CDD:304433 62/245 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.