DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and Adgrg7

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_766413.2 Gene:Adgrg7 / 239853 MGIID:2441732 Length:785 Species:Mus musculus


Alignment Length:339 Identity:71/339 - (20%)
Similarity:134/339 - (39%) Gaps:103/339 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 PKSMPAVPQVG-TISMVGCILTIAVYLYIKKLRN------LLGKCFICYVF-CKFV-------QY 248
            |||:..:..:| .:|:.|..|||...:..:|:|.      |:..|....:| ..||       :.
Mouse   428 PKSLDILSNIGCALSIAGLALTILFQILTRKIRKTSVTWVLVSLCSSMLIFNLLFVFGIENSNKN 492

  Fly   249 LIWAGGDLNLW---------------NNICSLAGYTNYFFALASHFWLSVMSHQIW----KNLRL 294
            |..:..|:|:.               |..|:......::|.|.:..|..:.:.|::    :.::.
Mouse   493 LKTSDSDINVKPENNKIPESDTIETPNPSCTAIAALLHYFLLVTFTWNGLSATQLYFLLIRTMKP 557

  Fly   295 INRDERSYHFLIY-NIYGWGTPAIMTAIT----YLVD-----WAWEDRPDKLNWIPGVGLYRCWI 349
            :.|     ||:|: ::.|||.|||:..:|    |.:.     |..:.|.:::          ||:
Mouse   558 LPR-----HFIIFISLVGWGVPAIIVGVTIGSIYALSGNKRYWELDYRQEEI----------CWL 607

  Fly   350 -----NTYD-----WSAMIYLYGPMLILSLFNVVTF-ILTVNHIMKIKSSVKSSTQQQRKCIQNN 403
                 |.|.     ||.:|    |:.|:.:.|:..| |:||..:.|...::.|:    :|.....
Mouse   608 AVPKDNDYARSPLLWSFII----PVTIILITNITIFVIITVKVLWKNNQNLTST----KKVSSLK 664

  Fly   404 DFLLYLRLSVMMGVTGISEVITYFVKRHKFWRQVLRVPN------------FFHLGSGIVVFVLF 456
            .....|.::|:.|||.|   :.|          .:.:.|            .|:...|:.:|:|:
Mouse   665 KVFSTLSIAVVFGVTWI---LAY----------AMLISNDDIRIVFSYIFCLFNTTQGLQIFILY 716

  Fly   457 ILKRSTFQMIMERI 470
            .::...||....:|
Mouse   717 TVRTKVFQSEASKI 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 51/240 (21%)
Adgrg7NP_766413.2 GPS 380..418 CDD:280071
7tm_4 430..710 CDD:304433 63/315 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.