DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and Adgrg2

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_006528869.1 Gene:Adgrg2 / 237175 MGIID:2446854 Length:1092 Species:Mus musculus


Alignment Length:247 Identity:60/247 - (24%)
Similarity:101/247 - (40%) Gaps:50/247 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 PKSMPAVPQVGTISMVGCIL-------TIAVYLYIKKL-RNLLGKCFICYVFCKFVQYLIWAGGD 255
            |..|.|:.   .|:.:||.|       |:..|:..:|: |:...|..|.......:..||:.   
Mouse   697 PSQMMALT---FITYIGCGLSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALLLLNLIFL--- 755

  Fly   256 LNLW------NNICSLAGYTNYFFALASHFWLSVMS-HQIWKNLRLINRDERSYHFLIYNIYGWG 313
            |:.|      ...|.......::|.|.|..|:.:.: |.....:::.|...|.| .|.:.|.|||
Mouse   756 LDSWIALYNTRGFCIAVAVFLHYFLLVSFTWMGLEAFHMYLALVKVFNTYIRKY-ILKFCIVGWG 819

  Fly   314 TPAIMTAITYLVDWAWEDRPDKLNWIPGVGLYR----------CWINTYDWSAMIYL--YGPMLI 366
            .||::.:|...:.      ||..    |:|.|.          ||||:   :.:.|:  .|...:
Mouse   820 IPAVVVSIVLTIS------PDNY----GIGSYGKFPNGTPDDFCWINS---NVVFYITVVGYFCV 871

  Fly   367 LSLFNVVTFILTVNHIMKIKSSVKSSTQQQRKCIQNNDFLLYLRLSVMMGVT 418
            :.|.||..||:.:..:.:||.. |....|::..||  |......|:.::|:|
Mouse   872 IFLLNVSMFIVVLVQLCRIKKK-KQLGAQRKTSIQ--DLRSIAGLTFLLGIT 920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 51/213 (24%)
Adgrg2XP_006528869.1 Atrophin-1 <288..>423 CDD:367360
PRK14948 <368..559 CDD:237862
GPS 637..687 CDD:366827
7tmB2_GPR64 700..969 CDD:320560 59/244 (24%)
TM helix 1 703..727 CDD:320560 6/26 (23%)
TM helix 2 737..758 CDD:320560 5/23 (22%)
TM helix 3 770..792 CDD:320560 4/21 (19%)
TM helix 4 812..828 CDD:320560 6/15 (40%)
TM helix 5 858..881 CDD:320560 5/22 (23%)
TM helix 6 904..929 CDD:320560 6/19 (32%)
TM helix 7 933..958 CDD:320560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.