| Sequence 1: | NP_788473.1 | Gene: | mthl6 / 38839 | FlyBaseID: | FBgn0035789 | Length: | 480 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001352934.1 | Gene: | ADGRL2 / 23266 | HGNCID: | 18582 | Length: | 1469 | Species: | Homo sapiens |
| Alignment Length: | 260 | Identity: | 55/260 - (21%) |
|---|---|---|---|
| Similarity: | 107/260 - (41%) | Gaps: | 47/260 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 208 VGTISMVGCILTIAVYLYIKKLRNLLGKCFICYVFCKFVQYLIWAGGDLNLWNNICSL-AGYTNY 271
Fly 272 FFALASHFWLSVMSHQIWKNLRLINRDERSY-HFLIYNIYGWGTPAIMTAITYLVDWAWEDRPDK 335
Fly 336 LNWIPGVGLYR-CWI---NTYDWSAMIYLYGPMLILSLFNVVTFILTVNHIMKIKSSVK--SSTQ 394
Fly 395 QQRKCIQNNDF--LLYLRLSVMMGVTGISE---VITYFVKRHKFWRQVLRVPNFFHLGSGIVVFV 454
Fly 455 454 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| mthl6 | NP_788473.1 | Mth_Ecto | 25..197 | CDD:119403 | |
| 7tm_4 | 211..398 | CDD:304433 | 42/194 (22%) | ||
| ADGRL2 | NP_001352934.1 | Gal_Lectin | 49..129 | CDD:307994 | |
| OLF | 142..398 | CDD:321983 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 426..460 | ||||
| HormR | 469..533 | CDD:214468 | |||
| GAIN | 542..764 | CDD:318649 | |||
| GPS | 788..840 | CDD:197639 | |||
| 7tmB2_Latrophilin-2 | 848..1105 | CDD:320672 | 55/260 (21%) | ||
| TM helix 1 | 850..875 | CDD:320672 | 3/13 (23%) | ||
| TM helix 2 | 884..906 | CDD:320672 | 4/23 (17%) | ||
| TM helix 3 | 915..942 | CDD:320672 | 8/29 (28%) | ||
| TM helix 4 | 954..974 | CDD:320672 | 4/19 (21%) | ||
| TM helix 5 | 991..1020 | CDD:320672 | 8/32 (25%) | ||
| TM helix 6 | 1036..1063 | CDD:320672 | 6/26 (23%) | ||
| TM helix 7 | 1067..1092 | CDD:320672 | 5/33 (15%) | ||
| Latrophilin | 1104..1469 | CDD:308136 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1368..1410 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4193 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||