DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and ADGRF2

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001355044.1 Gene:ADGRF2 / 222611 HGNCID:18991 Length:708 Species:Homo sapiens


Alignment Length:256 Identity:51/256 - (19%)
Similarity:99/256 - (38%) Gaps:77/256 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 ILTIAVYLYIKKLRNLLGKCFICYVFCKFVQYLIWA------------------GGDL---NLW- 259
            |||...|:.       ||......:.|..::.|:|:                  ...|   ::| 
Human   445 ILTYITYVG-------LGISICSLILCLSIEVLVWSQVTKTEITYLRHVCIVNIAATLLMADVWF 502

  Fly   260 ------------NNICSLAGYTNYFFALASHFWLSVMSHQIWKNLRLINRDERSYHFL------- 305
                        :..|..|.:..:||.|:..||:...:..|...:.::      :|.|       
Human   503 IVASFLSGPITHHKGCVAATFFVHFFYLSVFFWMLAKALLILYGIMIV------FHTLPKSVLVA 561

  Fly   306 -IYNIYGWGTPAIMTAITYLVDWAWEDRPDKLNWIPGVGLYR---CWINTYDWSAMIYLYGPMLI 366
             :::: |:|.|..:.|||..   |.|         ||.|..|   ||:|.....|::....|.|.
Human   562 SLFSV-GYGCPLAIAAITVA---ATE---------PGKGYLRPEICWLNWDMTKALLAFVIPALA 613

  Fly   367 LSLFNVVTFILTVNHIMKIKSSVKSSTQQQRKCIQNNDFLLYLRLSVMMGVT---GISEVI 424
            :.:.|::|..|.:  :...::::.:|..|:.:.|......:.: |:.::|:|   |::.||
Human   614 IVVVNLITVTLVI--VKTQRAAIGNSMFQEVRAIVRISKNIAI-LTPLLGLTWGFGVATVI 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 44/225 (20%)
ADGRF2NP_001355044.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.