DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and lat-2

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001040724.1 Gene:lat-2 / 173771 WormBaseID:WBGene00002252 Length:1338 Species:Caenorhabditis elegans


Alignment Length:274 Identity:58/274 - (21%)
Similarity:119/274 - (43%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 IPKSMPAVPQVG-TISMVGCILTIAVYLYIKKLRNLLGKCFICYVFCKFVQYLIWAGGDLNLWNN 261
            :..::..|..:| .||:|...|::.|:.:.:.|:|:..........|..:..|::..|.....|.
 Worm   893 LASALDVVSTIGCAISIVCLALSVCVFTFFRNLQNVRNSIHRNLCLCLLIAELVFVIGMDRTGNR 957

  Fly   262 I-CSLAGYTNYFFALASHFWLSVMSHQIWKNLRLINRDERSYHFLIYNIYGWGTPAIMTAITYLV 325
            . |.:.....::|.|:|..|:.:..:|::..|..:....|:..||.| ::.:||||::.||:..:
 Worm   958 TGCGVVAILLHYFFLSSFCWMLLEGYQLYMMLIQVFEPNRTRIFLYY-LFCYGTPAVVVAISAGI 1021

  Fly   326 DWAWEDRPDKLNWIPGVGLYRCWINTYD---WSAMIYLYGPMLILSLFNVVTFILTVNHIMKIKS 387
              .|||.        |...| |||:|..   |:    ...|::::...|::..::.:..::.::|
 Worm  1022 --KWEDY--------GTDSY-CWIDTSTPTIWA----FVAPIIVIIAANIIFLLIALKVVLSVQS 1071

  Fly   388 SVKSSTQQQRKCIQNNDFLLYLR--------LSVMMGVTGISEVITYFVKRHKFWRQVLRVPNFF 444
            ..::...:....::.:..||.|.        |:.:.|.||     |.|.     |     :....
 Worm  1072 RDRTKWGRIIGWLKGSATLLCLLGITWIFGFLTAVKGGTG-----TAFA-----W-----IFTIL 1121

  Fly   445 HLGSGIVVFVLFIL 458
            :...||.:|||.::
 Worm  1122 NCTQGIFIFVLHVV 1135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 41/190 (22%)
lat-2NP_001040724.1 CLECT 52..193 CDD:214480
Gal_Lectin 242..322 CDD:280328
CLECT 330..>399 CDD:295302
HormR 479..542 CDD:214468
GAIN 556..>660 CDD:293098
GPS 837..884 CDD:197639
7tm_4 894..1129 CDD:304433 55/265 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.