DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and Adgrl2

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_599235.3 Gene:Adgrl2 / 171447 RGDID:620835 Length:1487 Species:Rattus norvegicus


Alignment Length:194 Identity:42/194 - (21%)
Similarity:85/194 - (43%) Gaps:27/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 VGTISMVGCILTIAVYLYIKKLRNLLGKCFICYVFCKFVQYLIWAGGDLNLWNNICSL-AGYTNY 271
            |..:.:..||.|...:..::..||.:.|.....:|  ..:::...|.|...:...|.: ||..::
  Rat   861 VSLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLF--IAEFIFLIGIDKTQYTIACPVFAGLLHF 923

  Fly   272 FFALASHFWLSVMSHQIWKNLRLINRDERSY-HFLIYNIYGWGTPAIMTAITYLVDWAWEDRPDK 335
            || ||:..|:.:...|::  |.|:...|..| ....|.:.|:..||.:..::..:|:        
  Rat   924 FF-LAAFSWMCLEGVQLY--LMLVEVFESEYSRKKYYYVAGYLFPATVVGVSAAIDY-------- 977

  Fly   336 LNWIPGVG-LYRCWI---NTYDWSAMIYLYGPMLILSLFNVVTFILTVNHIMKIKSSVKSSTQQ 395
                ...| |..||:   |.:.||    ..||:..:.|.|::..::|:..::|..:::|..:.:
  Rat   978 ----KSYGTLEACWLHVDNYFIWS----FIGPVTFIILLNIIFLVITLCKMVKHSNTLKPDSSR 1033

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 41/191 (21%)
Adgrl2NP_599235.3 Gal_Lectin 49..129 CDD:396628
OLF 142..398 CDD:413369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..462
HormR 469..533 CDD:214468
GAIN 542..764 CDD:406802
GPS 788..840 CDD:197639
7tm_GPCRs 848..1129 CDD:421689 42/194 (22%)
TM helix 1 850..875 CDD:410628 4/13 (31%)
TM helix 2 884..906 CDD:410628 4/23 (17%)
TM helix 3 915..942 CDD:410628 8/29 (28%)
TM helix 4 954..974 CDD:410628 4/19 (21%)
TM helix 5 991..1020 CDD:410628 8/32 (25%)
TM helix 6 1036..1087 CDD:410628
TM helix 7 1091..1116 CDD:410628
Latrophilin 1128..1487 CDD:396778
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1139..1160
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1386..1428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.