DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and adgrg2a

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_005162818.2 Gene:adgrg2a / 101882832 ZFINID:ZDB-GENE-140106-206 Length:2289 Species:Danio rerio


Alignment Length:280 Identity:56/280 - (20%)
Similarity:110/280 - (39%) Gaps:68/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 ISMVGC-------ILTIAVYLYIKKLRN------LLGKCFICYVFCKFVQYLI--WAGGDLNLWN 260
            ||.:||       .:|:..||...|:|.      |:..|| ..:|...| :|:  |    |.|:.
Zfish  1934 ISYIGCGVSAIFLSVTLLTYLSFDKIRRDIPSKILIHLCF-ALLFLNLV-FLLDSW----LALYT 1992

  Fly   261 N---ICSLAGYTNYFFALASHFWLSVMSHQIWKNLRLINRDERSYHFLIYNIYGWGTPAIMTAIT 322
            :   :|....:..::|.|.|..|:.:.:..::..:..:..:..|.:.|.:::.|||.|..:..|.
Zfish  1993 DAVGLCISTAFFLHYFLLVSFTWMGLEALHMYLAIVKVFNNFMSRYMLKFSLIGWGVPLAVVIIV 2057

  Fly   323 YLVDWAWEDRPDKLNW-IPGVGLYR-------CWI-NTYDWSAMIYLYGPMLILSLFNVVTFILT 378
            ..:        :|.|: :...|.:.       ||: |:..:...:..|  ..|:.:.|:..|::.
Zfish  2058 IAI--------NKDNYGLISYGKFSDGTTDDFCWLKNSTAFYVAVVAY--FCIIFVLNLAMFVVV 2112

  Fly   379 VNHIMKIKSSVKSSTQQQRKCIQNNDFLLYLRLSVMMGVT---------GISEVITYFVKRHKFW 434
            :.|:.:||.. .....|.|..:|  |......|:.::|:|         .::...||..      
Zfish  2113 MVHLRRIKRR-NPHNNQYRSGVQ--DLRSIAGLTFLLGLTWGFAFFAWGPVNLAFTYLF------ 2168

  Fly   435 RQVLRVPNFFHLGSGIVVFV 454
                   :.|:...|..:||
Zfish  2169 -------SIFNCLQGFFIFV 2181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 44/213 (21%)
adgrg2aXP_005162818.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.