DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl6 and ADGRG2

DIOPT Version :9

Sequence 1:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001073327.1 Gene:ADGRG2 / 10149 HGNCID:4516 Length:1017 Species:Homo sapiens


Alignment Length:296 Identity:70/296 - (23%)
Similarity:123/296 - (41%) Gaps:66/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 IPKSMPAVPQVGTISMVGCIL-------TIAVYLYIKKL-RNLLGKCFICYVFCKFVQYLIWAGG 254
            :|..|.|:.   .|:.:||.|       |:..|:..:|: |:...|..|.......:..|::.  
Human   621 LPAQMMALT---FITYIGCGLSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALLLLNLVFL-- 680

  Fly   255 DLNLW------NNIC-SLAGYTNYFFALASHFWLSVMS-HQIWKNLRLINRDERSYHFLIYNIYG 311
             |:.|      ..:| |:|.:.:||. |.|..|:.:.: |.....:::.|...|.| .|.:.|.|
Human   681 -LDSWIALYKMQGLCISVAVFLHYFL-LVSFTWMGLEAFHMYLALVKVFNTYIRKY-ILKFCIVG 742

  Fly   312 WGTPAIMTAITYLVDWAWEDRPDKLNWIPGVGLYR----------CWINTYDWSAMIYL--YGPM 364
            ||.||::..|...:.      ||..    |:|.|.          ||||.   :|:.|:  .|..
Human   743 WGVPAVVVTIILTIS------PDNY----GLGSYGKFPNGSPDDFCWINN---NAVFYITVVGYF 794

  Fly   365 LILSLFNVVTFILTVNHIMKIKSSVKSSTQQQRKCIQNNDFLLYLRLSVMMGVT-GISEVITYFV 428
            .::.|.||..||:.:..:.:||.. |....|::..||  |......|:.::|:| |.:    :|.
Human   795 CVIFLLNVSMFIVVLVQLCRIKKK-KQLGAQRKTSIQ--DLRSIAGLTFLLGITWGFA----FFA 852

  Fly   429 KRHKFWRQV----LRVPNFFHLGSGIVVFVLFILKR 460
                 |..|    :.:...|:...|..:|:.:.:.:
Human   853 -----WGPVNVTFMYLFAIFNTLQGFFIFIFYCVAK 883

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403
7tm_4 211..398 CDD:304433 54/214 (25%)
ADGRG2NP_001073327.1 GPS 569..612 CDD:280071
7tm_4 625..875 CDD:304433 68/282 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.