DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8541 and CG42323

DIOPT Version :9

Sequence 1:NP_648127.1 Gene:CG8541 / 38838 FlyBaseID:FBgn0035788 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001138219.1 Gene:CG42323 / 32825 FlyBaseID:FBgn0259223 Length:259 Species:Drosophila melanogaster


Alignment Length:330 Identity:95/330 - (28%)
Similarity:126/330 - (38%) Gaps:126/330 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFRYLIS--LCALVACANA--GLLASHVAIANPSVD--AVASTQQNVVRSFAG--TVSSYSKAV 57
            |||:.::|  |.||:||..|  |..|:: :|:.||||  :|.|||::.|:...|  :.|.|:..|
  Fly     1 MAFKVILSVVLVALIACVQAKPGGPAAY-SISAPSVDHASVGSTQEHTVKGHYGQSSQSDYASQV 64

  Fly    58 DTPYSSVRKSDTRIQNNVYTPAIKTTTYGAAPLYTQATPIVSKTLVHAPAPVVEKTVYAAAPAPV 122
            .|.:|......:.|.|:.          |.||:....                    ||||||..
  Fly    65 QTAHSQSHVQRSSISNDA----------GLAPVAAHG--------------------YAAAPAHA 99

  Fly   123 LAKTVYSAPAPVVAKHVYSAPAQV--------YAPAAPVVAKT---------------------- 157
            :|     |||..:....::||||:        ||.:||.|..:                      
  Fly   100 IA-----APAYSLGYAGHTAPAQIQGVAYGGHYAASAPAVQISGLGHSLGLGHSLGLGQSLGLGG 159

  Fly   158 ----------VYSAPAPV----YAAPAPVYAAPAPVVAKTVYSAPAPVLAKTVYSAPAPVYAASA 208
                      .||| |||    |.|.|||  |.||||......:.||.:........||.|||.|
  Fly   160 YGGYGYGGYGSYSA-APVISHGYLAHAPV--AAAPVVKYAAAPSYAPGIIGHGIGLAAPAYAAPA 221

  Fly   209 PAVAKTVSYAAPLATTNVNHGP---AATTYTHNAPALGVSSYGSSQTVHYSPAESVSHMSFDGFG 270
                    ||||...|:: .||   ||..    ||||                   .|.|..|.|
  Fly   222 --------YAAPAYATHL-AGPVVKAAVA----APAL-------------------VHTSVSGHG 254

  Fly   271 THWGF 275
            .|:|:
  Fly   255 IHYGY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8541NP_648127.1 Cuticle_3 33..275 CDD:287932 78/292 (27%)
CG42323NP_001138219.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.