DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8543 and CG8541

DIOPT Version :9

Sequence 1:NP_648126.1 Gene:CG8543 / 38837 FlyBaseID:FBgn0035787 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_648127.1 Gene:CG8541 / 38838 FlyBaseID:FBgn0035788 Length:275 Species:Drosophila melanogaster


Alignment Length:289 Identity:154/289 - (53%)
Similarity:173/289 - (59%) Gaps:84/289 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKYVLLSFCALVGVASAGFLAPATTYAAASIPVVAKVAQPHYDAVGTTQQNVVRSFGGTVSTY 65
            |||:| |:|.||||..|:||.||   ::.|        :|.|..|||.:|||||||||.||||:|
  Fly     1 MAFRY-LISLCALVACANAGLLA---SHVA--------IANPSVDAVASTQQNVVRSFAGTVSSY 53

  Fly    66 SKNVVTPYSSVSKVDSRITNNVYTP---------------------KTLYSAPAPVITKSFYAAA 109
            ||.|.||||||.|.|:||.||||||                     |||..|||||:.|:.||||
  Fly    54 SKAVDTPYSSVRKSDTRIQNNVYTPAIKTTTYGAAPLYTQATPIVSKTLVHAPAPVVEKTVYAAA 118

  Fly   110 PAPVVAKTVYSAP---VAKAVYAAPAPVYAAPAPVVAKTVYSAPVAKAVYAAPAPVYSAPAPVVA 171
            ||||:||||||||   |||.||:|||.|||..||||||||||||.  .|||||||||:|||||||
  Fly   119 PAPVLAKTVYSAPAPVVAKHVYSAPAQVYAPAAPVVAKTVYSAPA--PVYAAPAPVYAAPAPVVA 181

  Fly   172 KTVYSAPAP-----VYHAPAPLVAAA----------------------PAA-------------- 195
            |||||||||     ||.||||:.||:                      |||              
  Fly   182 KTVYSAPAPVLAKTVYSAPAPVYAASAPAVAKTVSYAAPLATTNVNHGPAATTYTHNAPALGVSS 246

  Fly   196 -----YVKYSPAAVVAHASFDGFGSHWGY 219
                 .|.||||..|:|.||||||:|||:
  Fly   247 YGSSQTVHYSPAESVSHMSFDGFGTHWGF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8543NP_648126.1 Cuticle_3 43..219 CDD:287932 135/245 (55%)
CG8541NP_648127.1 Cuticle_3 33..275 CDD:287932 135/243 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469376
Domainoid 1 1.000 94 1.000 Domainoid score I13839
eggNOG 1 0.900 - - E1_2C3DU
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I6959
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D76018at7147
OrthoFinder 1 1.000 - - FOG0014264
OrthoInspector 1 1.000 - - mtm9613
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11763
109.900

Return to query results.
Submit another query.