DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8543 and CG42323

DIOPT Version :9

Sequence 1:NP_648126.1 Gene:CG8543 / 38837 FlyBaseID:FBgn0035787 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001138219.1 Gene:CG42323 / 32825 FlyBaseID:FBgn0259223 Length:259 Species:Drosophila melanogaster


Alignment Length:287 Identity:84/287 - (29%)
Similarity:109/287 - (37%) Gaps:96/287 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKYVL-LSFCALVGVASAGFLAPATTYAAASIPVVAKVAQPHYD--AVGTTQQNVVRSFGG-- 60
            ||||.:| :...||:          |...|....|....::.|..|  :||:||::.|:...|  
  Fly     1 MAFKVILSVVLVALI----------ACVQAKPGGPAAYSISAPSVDHASVGSTQEHTVKGHYGQS 55

  Fly    61 TVSTYSKNVVTPYSSVSKVDSRITNNVYTPKTLYSAPAPVITKSFYAAAPAPVVAKTVYSAPVAK 125
            :.|.|:..|.|.:|......|.|:|:        :..|||.... ||||||..:|...||  :..
  Fly    56 SQSDYASQVQTAHSQSHVQRSSISND--------AGLAPVAAHG-YAAAPAHAIAAPAYS--LGY 109

  Fly   126 AVYAAPAPV--------YAAPAPVVAKT--------------------------------VYS-A 149
            |.:.|||.:        |||.||.|..:                                .|| |
  Fly   110 AGHTAPAQIQGVAYGGHYAASAPAVQISGLGHSLGLGHSLGLGQSLGLGGYGGYGYGGYGSYSAA 174

  Fly   150 PVAKAVYAAPAPVYSAP----------------------APVVAKTVYSAPAPVYHAPAPLVAAA 192
            ||....|.|.|||.:||                      ||..|...|:|||...|...|:|.||
  Fly   175 PVISHGYLAHAPVAAAPVVKYAAAPSYAPGIIGHGIGLAAPAYAAPAYAAPAYATHLAGPVVKAA 239

  Fly   193 PAAYVKYSPAAVVAHASFDGFGSHWGY 219
            .||     ||.|  |.|..|.|.|:||
  Fly   240 VAA-----PALV--HTSVSGHGIHYGY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8543NP_648126.1 Cuticle_3 43..219 CDD:287932 71/242 (29%)
CG42323NP_001138219.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR39068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.