DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMIGD1 and DIP-lambda

DIOPT Version :9

Sequence 1:NP_996663.1 Gene:TMIGD1 / 388364 HGNCID:32431 Length:262 Species:Homo sapiens
Sequence 2:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster


Alignment Length:269 Identity:63/269 - (23%)
Similarity:115/269 - (42%) Gaps:65/269 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    14 FLLLVILFLPREMTSSVLTVNGKTENYILD----------TTP-GSQASLICAVQN--HTREEEL 65
            |:|:..:.:.:  ..:|..::||.|:..:|          |.| |...|..|.|.|  |.|   :
  Fly    22 FILIKAITITK--CHAVAHIHGKGESEEIDPQFLAKLSNTTVPIGRDISFTCVVDNLGHYR---V 81

Human    66 LWYREEGRVDL--------------KSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVV 116
            .|.:.:.:..|              .:.|..|:..:.:|.:..||:| |:.|::..|...|:|..
  Fly    82 AWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSG-SYMCQVNTDPMKSLSGY 145

Human   117 LNVTFPPLLSGNDFQTVE-----EGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTS- 175
            |:|..||.:..:.....|     ||.::.|:|:|...|:.:::|.:       |..:..|.:|. 
  Fly   146 LDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRR-------EAGKEIILRTDG 203

Human   176 ---------ESFQLSITKVEKPDNGTYSCIAKSSL-KTESLDFHLIVK--------DKTVGVPIE 222
                     |..:|.:|.|::.|.|.|:|||.:.: .:.|..|::.|.        .:.||.|:|
  Fly   204 RDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQLVGAPVE 268

Human   223 -PIIAACVV 230
             .:...|:|
  Fly   269 REVTLECIV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TMIGD1NP_996663.1 IG 131..212 CDD:214652 23/96 (24%)
DIP-lambdaNP_001334747.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11661
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.