DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk26 and F58G6.8

DIOPT Version :9

Sequence 1:NP_648125.3 Gene:ppk26 / 38835 FlyBaseID:FBgn0035785 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001023246.2 Gene:F58G6.8 / 3565898 WormBaseID:WBGene00010278 Length:162 Species:Caenorhabditis elegans


Alignment Length:153 Identity:27/153 - (17%)
Similarity:67/153 - (43%) Gaps:23/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RETVSDDSEDEVDTKKQIKYGSGFQAAKAIIHE----------------YCDYTTIHGIRYLGEK 89
            ::::||:.:.::|..:.....|..:..|  :|:                :.:..||||:.::.: 
 Worm    13 KDSLSDEFDSDLDDNEMKAIVSDIEQDK--LHDETPDTRWIQFKNHLKNWGETATIHGVPHMAQ- 74

  Fly    90 KRPLLERLFWISVLVLSVFTCVKLTLNIWDKWNNNPVIVSFAEKSTPVWQIPFPAVTVCPETKTR 154
            ...::..:.|..:|::|....|.:..:|...:....|:|:.   :|.:...|||::|.|.....:
 Worm    75 AHTVIAIIVWSIILIVSAVAFVYMFYSIAASYLAFNVVVNL---NTGLDSEPFPSITFCNTNPYK 136

  Fly   155 -REIFNFTDSYHQVRDFQSNVSG 176
             .|:.|..:....:..:|::..|
 Worm   137 LSEMVNVPELNALLTVYQASADG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk26NP_648125.3 ASC 74..570 CDD:279230 21/104 (20%)
F58G6.8NP_001023246.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.