DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx2 and C1S

DIOPT Version :9

Sequence 1:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001725.1 Gene:C1S / 716 HGNCID:1247 Length:688 Species:Homo sapiens


Alignment Length:264 Identity:66/264 - (25%)
Similarity:102/264 - (38%) Gaps:68/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RITGGYRAK----PYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVKEVLIFKYIEA----- 80
            ||.||..|.    |:.:.:       .:|     :..|.:|:..|:||...|     :|.     
Human   437 RIIGGSDADIKNFPWQVFF-------DNP-----WAGGALINEYWVLTAAHV-----VEGNREPT 484

  Fly    81 -HFGS----------------KRAFW--GYDILRIYRENFYFHYDKTRIIALV--KCPYQKFDRR 124
             :.||                :..|.  |:.:|.:......|..|    ||||  |.|. |....
Human   485 MYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDND----IALVRLKDPV-KMGPT 544

  Fly   125 MSRVRVPAYGARFERYVGNMTMVCGWG-TDKR-------KVRLPT--WMRCVEVEVMNNTECAKY 179
            :|.:.:|...:.:....|::.::.||| |:||       ..|||.  ..:|.||:|...|..|:.
Human   545 VSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEA 609

  Fly   180 H--TPLKWYEMCTSGEGFKGVCEGDMGGAVVTMGPN-PTFIGIIWLMPTNCSIGYPSVHIRVSDH 241
            :  ||   ..:|..||.....|:||.|||.....|| .|......|:......|...::.||.::
Human   610 YVFTP---NMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGLYTRVKNY 671

  Fly   242 IKWI 245
            :.||
Human   672 VDWI 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 64/262 (24%)
Tryp_SPc 26..248 CDD:304450 65/263 (25%)
C1SNP_001725.1 CUB 18..129 CDD:238001
FXa_inhibition 143..171 CDD:405372
CUB 175..287 CDD:395345
CCP 294..355 CDD:153056
Sushi 359..421 CDD:395037
Tryp_SPc 438..678 CDD:238113 65/263 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.